Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1822..2357 Replicon plasmid pINV
Accession NZ_CP109776
Organism Shigella sonnei strain CIP_106347

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag OHN14_RS24315 Protein ID WP_000222766.1
Coordinates 2070..2357 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0I0JNN8
Locus tag OHN14_RS24310 Protein ID WP_001132903.1
Coordinates 1822..2073 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHN14_RS24300 (OHN14_24300) 1..858 + 858 WP_000130974.1 incFII family plasmid replication initiator RepA -
OHN14_RS24305 (OHN14_24305) 1558..1749 + 192 WP_000829591.1 hypothetical protein -
OHN14_RS24310 (OHN14_24310) 1822..2073 + 252 WP_001132903.1 plasmid stabilization protein Antitoxin
OHN14_RS24315 (OHN14_24315) 2070..2357 + 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OHN14_RS24320 (OHN14_24320) 2590..3789 - 1200 WP_000947184.1 IS91 family transposase -
OHN14_RS24325 (OHN14_24325) 3799..3987 - 189 WP_000957853.1 hypothetical protein -
OHN14_RS24330 (OHN14_24330) 4109..4267 + 159 Protein_6 transposase -
OHN14_RS24335 (OHN14_24335) 4406..4561 + 156 Protein_7 IS256 family transposase -
OHN14_RS24340 (OHN14_24340) 4591..6318 - 1728 WP_000597732.1 T3SS effector E3 ubiquitin-protein ligase IpaH1.4 -
OHN14_RS24345 (OHN14_24345) 6708..6927 - 220 Protein_9 hypothetical protein -
OHN14_RS24350 (OHN14_24350) 7084..7181 - 98 Protein_10 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaH1.4 / tviC / nleE / icsP/sopA / ospB / ospC4 / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG 1..214749 214749


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T262111 WP_000222766.1 NZ_CP109776:2070-2357 [Shigella sonnei]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9225.44 Da        Isoelectric Point: 4.0927

>AT262111 WP_001132903.1 NZ_CP109776:1822-2073 [Shigella sonnei]
MPNIILSETSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB A0A0I0JNN8

References