Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3381390..3382227 | Replicon | chromosome |
Accession | NZ_CP109775 | ||
Organism | Shigella sonnei strain CIP_106347 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | OHN14_RS17350 | Protein ID | WP_000227784.1 |
Coordinates | 3381685..3382227 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | OHN14_RS17345 | Protein ID | WP_001297137.1 |
Coordinates | 3381390..3381701 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHN14_RS17320 (3376410) | 3376410..3377357 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
OHN14_RS17325 (3377379) | 3377379..3379370 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
OHN14_RS17330 (3379360) | 3379360..3379974 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
OHN14_RS17335 (3379974) | 3379974..3380303 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
OHN14_RS17340 (3380315) | 3380315..3381205 | + | 891 | WP_000971327.1 | heme o synthase | - |
OHN14_RS17345 (3381390) | 3381390..3381701 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
OHN14_RS17350 (3381685) | 3381685..3382227 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
OHN14_RS17355 (3382283) | 3382283..3382849 | - | 567 | Protein_3393 | SEL1-like repeat protein | - |
OHN14_RS17360 (3382883) | 3382883..3383580 | + | 698 | WP_094096600.1 | IS1-like element IS1A family transposase | - |
OHN14_RS17365 (3383597) | 3383597..3383995 | - | 399 | Protein_3395 | SEL1-like repeat protein | - |
OHN14_RS17375 (3385180) | 3385180..3386544 | + | 1365 | WP_001000971.1 | MFS transporter | - |
OHN14_RS17380 (3386672) | 3386672..3387163 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T262108 WP_000227784.1 NZ_CP109775:3381685-3382227 [Shigella sonnei]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|