Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3343914..3344532 | Replicon | chromosome |
Accession | NZ_CP109775 | ||
Organism | Shigella sonnei strain CIP_106347 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | OHN14_RS17155 | Protein ID | WP_001291435.1 |
Coordinates | 3344314..3344532 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A0H8V4S8 |
Locus tag | OHN14_RS17150 | Protein ID | WP_000344804.1 |
Coordinates | 3343914..3344288 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHN14_RS17140 (3339003) | 3339003..3340196 | + | 1194 | WP_011310152.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OHN14_RS17145 (3340219) | 3340219..3343368 | + | 3150 | WP_001132464.1 | efflux RND transporter permease AcrB | - |
OHN14_RS17150 (3343914) | 3343914..3344288 | + | 375 | WP_000344804.1 | Hha toxicity modulator TomB | Antitoxin |
OHN14_RS17155 (3344314) | 3344314..3344532 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
OHN14_RS17160 (3344703) | 3344703..3345254 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
OHN14_RS17165 (3345370) | 3345370..3345840 | + | 471 | WP_000136192.1 | YlaC family protein | - |
OHN14_RS17170 (3346004) | 3346004..3347552 | + | 1549 | Protein_3357 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
OHN14_RS17175 (3347594) | 3347594..3347947 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
OHN14_RS17185 (3348326) | 3348326..3348637 | + | 312 | WP_000409911.1 | MGMT family protein | - |
OHN14_RS17190 (3348668) | 3348668..3349240 | - | 573 | WP_000779812.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T262107 WP_001291435.1 NZ_CP109775:3344314-3344532 [Shigella sonnei]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14615.43 Da Isoelectric Point: 4.6232
>AT262107 WP_000344804.1 NZ_CP109775:3343914-3344288 [Shigella sonnei]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIETFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIETFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H8V4S8 |