Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2160383..2160867 Replicon chromosome
Accession NZ_CP109775
Organism Shigella sonnei strain CIP_106347

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A377EAU1
Locus tag OHN14_RS11130 Protein ID WP_014334020.1
Coordinates 2160577..2160867 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A376K4R9
Locus tag OHN14_RS11125 Protein ID WP_005142544.1
Coordinates 2160383..2160577 (+) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHN14_RS11085 (2155578) 2155578..2155934 - 357 WP_005140877.1 hypothetical protein -
OHN14_RS11090 (2155992) 2155992..2156414 - 423 WP_001151171.1 DUF977 family protein -
OHN14_RS11095 (2156430) 2156430..2157155 - 726 WP_000450631.1 DUF1627 domain-containing protein -
OHN14_RS11100 (2157177) 2157177..2157923 - 747 WP_000788740.1 ATP-binding protein -
OHN14_RS11105 (2157930) 2157930..2158994 - 1065 WP_001262380.1 hypothetical protein -
OHN14_RS11110 (2159066) 2159066..2159491 - 426 WP_000693826.1 toxin YdaT family protein -
OHN14_RS11115 (2159488) 2159488..2159751 - 264 WP_001048456.1 helix-turn-helix transcriptional regulator -
OHN14_RS11120 (2159863) 2159863..2160363 + 501 WP_014334019.1 helix-turn-helix domain-containing protein -
OHN14_RS11125 (2160383) 2160383..2160577 + 195 WP_005142544.1 hypothetical protein Antitoxin
OHN14_RS11130 (2160577) 2160577..2160867 + 291 WP_014334020.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OHN14_RS11135 (2161147) 2161147..2161299 + 153 WP_000379558.1 DUF1391 family protein -
OHN14_RS11140 (2161311) 2161311..2161676 + 366 WP_024174355.1 hypothetical protein -
OHN14_RS11150 (2162579) 2162579..2163655 + 1077 Protein_2178 molybdopterin dinucleotide binding domain-containing protein -
OHN14_RS11155 (2163666) 2163666..2164283 + 618 WP_000213029.1 dimethylsulfoxide reductase subunit B -
OHN14_RS11160 (2164285) 2164285..2165139 + 855 WP_000526502.1 dimethyl sulfoxide reductase anchor subunit family protein -
OHN14_RS11165 (2165182) 2165182..2165796 + 615 WP_000148710.1 Tat proofreading chaperone DmsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vgrG/tssI / rhs/PAAR / rhs/PAAR / sodB 2023971..2251533 227562


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11062.93 Da        Isoelectric Point: 10.2013

>T262102 WP_014334020.1 NZ_CP109775:2160577-2160867 [Shigella sonnei]
MLPVLWLPSARDDLRQIVAYIAKENPAAARRMKIRIETSVLPLTEHPYLYPPSERVLGLREIVTHPNYIILYRVTASSIE
VVNIVHSRRQYPGKNS

Download         Length: 291 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7097.98 Da        Isoelectric Point: 4.1759

>AT262102 WP_005142544.1 NZ_CP109775:2160383-2160577 [Shigella sonnei]
MSTVLSPMVSEFETVEQENSYNEWLRAKVAASLADPRPAIPHDEVMAEMEQIIAQIAAATHRGE

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377EAU1

Antitoxin

Source ID Structure
AlphaFold DB A0A376K4R9

References