Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 50915..51651 | Replicon | plasmid pYZ-58-173k |
| Accession | NZ_CP109774 | ||
| Organism | Klebsiella pneumoniae strain YZ-58 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | M4Z05_RS27060 | Protein ID | WP_004187044.1 |
| Coordinates | 51169..51651 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | M4Z05_RS27055 | Protein ID | WP_003026799.1 |
| Coordinates | 50915..51181 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4Z05_RS27040 (M4Z05_27045) | 46387..47781 | + | 1395 | WP_032439652.1 | cytosine permease | - |
| M4Z05_RS27045 (M4Z05_27050) | 47793..49001 | + | 1209 | WP_032448288.1 | imidazolonepropionase | - |
| M4Z05_RS27050 (M4Z05_27055) | 48994..49803 | + | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
| M4Z05_RS27055 (M4Z05_27060) | 50915..51181 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| M4Z05_RS27060 (M4Z05_27065) | 51169..51651 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| M4Z05_RS27065 (M4Z05_27070) | 51862..53208 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
| M4Z05_RS27070 (M4Z05_27075) | 53368..54072 | + | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| M4Z05_RS27075 (M4Z05_27080) | 54349..55695 | + | 1347 | WP_077254728.1 | ISNCY family transposase | - |
| M4Z05_RS27080 (M4Z05_27085) | 55744..56142 | + | 399 | WP_032422684.1 | helix-turn-helix domain-containing protein | - |
| M4Z05_RS27085 (M4Z05_27090) | 56290..56442 | - | 153 | WP_264370054.1 | IS3 family transposase | - |
| M4Z05_RS27090 (M4Z05_27095) | 56416..56565 | - | 150 | Protein_65 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / sul2 / dfrA12 / aadA2 / tet(A) | iutA / iucD / iucC / iucB / iucA | 1..173418 | 173418 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T262096 WP_004187044.1 NZ_CP109774:51169-51651 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|