Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4747490..4748006 | Replicon | chromosome |
| Accession | NZ_CP109772 | ||
| Organism | Klebsiella pneumoniae strain YZ-58 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M4Z05_RS23595 | Protein ID | WP_040216106.1 |
| Coordinates | 4747490..4747774 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M4Z05_RS23600 | Protein ID | WP_002886901.1 |
| Coordinates | 4747764..4748006 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4Z05_RS23570 (M4Z05_23575) | 4742966..4743229 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| M4Z05_RS23575 (M4Z05_23580) | 4743359..4743532 | + | 174 | WP_004222159.1 | hypothetical protein | - |
| M4Z05_RS23580 (M4Z05_23585) | 4743535..4744278 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M4Z05_RS23585 (M4Z05_23590) | 4744635..4746773 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M4Z05_RS23590 (M4Z05_23595) | 4747022..4747486 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M4Z05_RS23595 (M4Z05_23600) | 4747490..4747774 | - | 285 | WP_040216106.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4Z05_RS23600 (M4Z05_23605) | 4747764..4748006 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M4Z05_RS23605 (M4Z05_23610) | 4748084..4749994 | - | 1911 | WP_032420841.1 | PRD domain-containing protein | - |
| M4Z05_RS23610 (M4Z05_23615) | 4750017..4751171 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| M4Z05_RS23615 (M4Z05_23620) | 4751238..4751978 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11097.94 Da Isoelectric Point: 10.4962
>T262093 WP_040216106.1 NZ_CP109772:c4747774-4747490 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|