Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4011086..4011705 Replicon chromosome
Accession NZ_CP109772
Organism Klebsiella pneumoniae strain YZ-58

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4Z05_RS20025 Protein ID WP_002892050.1
Coordinates 4011487..4011705 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M4Z05_RS20020 Protein ID WP_002892066.1
Coordinates 4011086..4011460 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4Z05_RS20010 (M4Z05_20015) 4006238..4007431 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M4Z05_RS20015 (M4Z05_20020) 4007454..4010600 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M4Z05_RS20020 (M4Z05_20025) 4011086..4011460 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M4Z05_RS20025 (M4Z05_20030) 4011487..4011705 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M4Z05_RS20030 (M4Z05_20035) 4011864..4012430 + 567 WP_002892030.1 maltose O-acetyltransferase -
M4Z05_RS20035 (M4Z05_20040) 4012402..4012542 - 141 WP_004147370.1 hypothetical protein -
M4Z05_RS20040 (M4Z05_20045) 4012563..4013033 + 471 WP_032419672.1 YlaC family protein -
M4Z05_RS20045 (M4Z05_20050) 4013008..4014459 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M4Z05_RS20050 (M4Z05_20055) 4014560..4015258 + 699 WP_004177238.1 GNAT family protein -
M4Z05_RS20055 (M4Z05_20060) 4015255..4015395 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M4Z05_RS20060 (M4Z05_20065) 4015395..4015658 - 264 WP_032419671.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T262091 WP_002892050.1 NZ_CP109772:4011487-4011705 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT262091 WP_002892066.1 NZ_CP109772:4011086-4011460 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References