Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 1856368..1857011 Replicon chromosome
Accession NZ_CP109772
Organism Klebsiella pneumoniae strain YZ-58

Toxin (Protein)


Gene name vagD Uniprot ID A4GZE5
Locus tag M4Z05_RS09450 Protein ID WP_015874977.1
Coordinates 1856368..1856784 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A4GZE4
Locus tag M4Z05_RS09455 Protein ID WP_015874976.1
Coordinates 1856781..1857011 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4Z05_RS09430 (M4Z05_09430) 1851771..1852886 - 1116 WP_032447702.1 salmochelin biosynthesis C-glycosyltransferase IroB -
M4Z05_RS09435 (M4Z05_09435) 1853059..1853337 - 279 Protein_1758 ISNCY family transposase -
M4Z05_RS09440 (M4Z05_09440) 1853758..1855932 + 2175 WP_015874979.1 siderophore salmochelin receptor IroN -
M4Z05_RS09445 (M4Z05_09445) 1856087..1856332 - 246 WP_032447699.1 hypothetical protein -
M4Z05_RS09450 (M4Z05_09450) 1856368..1856784 - 417 WP_015874977.1 type II toxin-antitoxin system VapC family toxin Toxin
M4Z05_RS09455 (M4Z05_09455) 1856781..1857011 - 231 WP_015874976.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M4Z05_RS09460 (M4Z05_09460) 1857454..1857834 + 381 WP_015874975.1 YrzE family protein -
M4Z05_RS09465 (M4Z05_09465) 1858022..1858992 + 971 Protein_1764 IS21-like element IS100 family transposase -
M4Z05_RS09470 (M4Z05_09470) 1859019..1859745 + 727 Protein_1765 IS21-like element helper ATPase IstB -
M4Z05_RS09475 (M4Z05_09475) 1859789..1859902 - 114 WP_015874970.1 Hha/YmoA family nucleoid-associated regulatory protein -
M4Z05_RS09480 (M4Z05_09480) 1860145..1860354 - 210 WP_032447696.1 TraR/DksA family transcriptional regulator -
M4Z05_RS09485 (M4Z05_09485) 1860344..1860925 - 582 WP_000937857.1 DUF2857 domain-containing protein -
M4Z05_RS09490 (M4Z05_09490) 1860910..1861092 - 183 WP_072001695.1 hypothetical protein -
M4Z05_RS09495 (M4Z05_09495) 1861114..1861299 - 186 WP_000205185.1 AlpA family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rmpA / iroD / iroC / iroB / iroN / fyuA / ybtE / ybtT / ybtU 1812389..1876687 64298


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14945.39 Da        Isoelectric Point: 8.5464

>T262084 WP_015874977.1 NZ_CP109772:c1856784-1856368 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAGLRGDRIVVSAVTYAEMRFGATGPKASPHHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8749.80 Da        Isoelectric Point: 4.3533

>AT262084 WP_015874976.1 NZ_CP109772:c1857011-1856781 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMVEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A4GZE5

Antitoxin

Source ID Structure
AlphaFold DB A4GZE4

References