Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 697843..698684 | Replicon | chromosome |
Accession | NZ_CP109772 | ||
Organism | Klebsiella pneumoniae strain YZ-58 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
Locus tag | M4Z05_RS03935 | Protein ID | WP_000854822.1 |
Coordinates | 698301..698684 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
Locus tag | M4Z05_RS03930 | Protein ID | WP_053271974.1 |
Coordinates | 697843..698211 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4Z05_RS03910 (M4Z05_03910) | 695588..696406 | + | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
M4Z05_RS03915 (M4Z05_03915) | 696497..696982 | + | 486 | WP_000214317.1 | antirestriction protein | - |
M4Z05_RS03920 (M4Z05_03920) | 696997..697473 | + | 477 | WP_001186747.1 | RadC family protein | - |
M4Z05_RS03925 (M4Z05_03925) | 697542..697763 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
M4Z05_RS03930 (M4Z05_03930) | 697843..698211 | + | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M4Z05_RS03935 (M4Z05_03935) | 698301..698684 | + | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
M4Z05_RS03940 (M4Z05_03940) | 698675..699163 | + | 489 | WP_001177592.1 | DUF5983 family protein | - |
M4Z05_RS03945 (M4Z05_03945) | 699130..699372 | + | 243 | WP_166635458.1 | DUF957 domain-containing protein | - |
M4Z05_RS03950 (M4Z05_03950) | 699469..700314 | + | 846 | Protein_690 | DUF4942 domain-containing protein | - |
M4Z05_RS03960 (M4Z05_03960) | 700613..701119 | + | 507 | WP_064149464.1 | G/U mismatch-specific DNA glycosylase | - |
M4Z05_RS03965 (M4Z05_03965) | 701219..703060 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | blaTEM-1B / aph(6)-Id / aph(3'')-Ib | - | 635157..705024 | 69867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T262082 WP_000854822.1 NZ_CP109772:698301-698684 [Klebsiella pneumoniae]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13679.41 Da Isoelectric Point: 6.4758
>AT262082 WP_053271974.1 NZ_CP109772:697843-698211 [Klebsiella pneumoniae]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0WJM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CWL2 |