Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 27206..28343 | Replicon | plasmid unnamed |
Accession | NZ_CP109759 | ||
Organism | Enterococcus faecium strain XJ78NG |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | OH471_RS12970 | Protein ID | WP_024417198.1 |
Coordinates | 27480..28343 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | OH471_RS12965 | Protein ID | WP_000301765.1 |
Coordinates | 27206..27478 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH471_RS12940 (OH471_12940) | 22673..23353 | - | 681 | WP_002323195.1 | IS6 family transposase | - |
OH471_RS12945 (OH471_12945) | 23423..24247 | + | 825 | Protein_30 | IS1380-like element ISSsu5 family transposase | - |
OH471_RS12950 (OH471_12950) | 24438..25925 | + | 1488 | WP_077149152.1 | type IA DNA topoisomerase | - |
OH471_RS12955 (OH471_12955) | 26014..26910 | + | 897 | WP_001835294.1 | ParA family protein | - |
OH471_RS12960 (OH471_12960) | 26974..27189 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
OH471_RS12965 (OH471_12965) | 27206..27478 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
OH471_RS12970 (OH471_12970) | 27480..28343 | + | 864 | WP_024417198.1 | zeta toxin family protein | Toxin |
OH471_RS12975 (OH471_12975) | 28474..28878 | + | 405 | Protein_36 | molecular chaperone DnaJ | - |
OH471_RS12980 (OH471_12980) | 29047..29643 | - | 597 | WP_002326773.1 | TetR/AcrR family transcriptional regulator | - |
OH471_RS12985 (OH471_12985) | 29954..30835 | + | 882 | WP_098379806.1 | ABC transporter ATP-binding protein | - |
OH471_RS12990 (OH471_12990) | 30859..32472 | + | 1614 | WP_098379807.1 | tetronasin resistance protein | - |
OH471_RS12995 (OH471_12995) | 32544..33119 | - | 576 | WP_230307287.1 | IS30 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | ant(6)-Ia / lsa(E) / lnu(B) / erm(B) / tet(L) / tet(M) | - | 1..62460 | 62460 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T262079 WP_024417198.1 NZ_CP109759:27480-28343 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|