Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 13983..15091 | Replicon | plasmid unnamed |
Accession | NZ_CP109759 | ||
Organism | Enterococcus faecium strain XJ78NG |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | OH471_RS12890 | Protein ID | WP_000233000.1 |
Coordinates | 14222..15091 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | OH471_RS12885 | Protein ID | WP_000205227.1 |
Coordinates | 13983..14207 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH471_RS12860 (OH471_12860) | 9254..10416 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
OH471_RS12865 (OH471_12865) | 10725..11051 | + | 327 | Protein_14 | DNA topoisomerase | - |
OH471_RS12870 (OH471_12870) | 11362..11859 | + | 498 | WP_002327635.1 | DNA recombinase | - |
OH471_RS12875 (OH471_12875) | 11860..12276 | + | 417 | WP_000323438.1 | recombinase | - |
OH471_RS12880 (OH471_12880) | 12278..13840 | + | 1563 | WP_000136908.1 | recombinase family protein | - |
OH471_RS12885 (OH471_12885) | 13983..14207 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OH471_RS12890 (OH471_12890) | 14222..15091 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
OH471_RS12895 (OH471_12895) | 15072..15806 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
OH471_RS12900 (OH471_12900) | 15839..16702 | + | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
OH471_RS12905 (OH471_12905) | 16746..17273 | + | 528 | WP_002294507.1 | phosphoribosyltransferase family protein | - |
OH471_RS12910 (OH471_12910) | 17405..18214 | + | 810 | WP_002294509.1 | ANT(9) family aminoglycoside nucleotidyltransferase Spw | - |
OH471_RS12915 (OH471_12915) | 18393..18683 | + | 291 | WP_010733534.1 | hypothetical protein | - |
OH471_RS12920 (OH471_12920) | 18734..19192 | - | 459 | WP_002325145.1 | hypothetical protein | - |
OH471_RS12925 (OH471_12925) | 19275..19838 | + | 564 | Protein_26 | recombinase zinc beta ribbon domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | ant(6)-Ia / lsa(E) / lnu(B) / erm(B) / tet(L) / tet(M) | - | 1..62460 | 62460 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T262078 WP_000233000.1 NZ_CP109759:14222-15091 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|