Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 481458..482029 | Replicon | chromosome |
| Accession | NZ_CP109758 | ||
| Organism | Enterococcus faecium strain XJ78NG | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | OH471_RS02295 | Protein ID | WP_002286801.1 |
| Coordinates | 481688..482029 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | OH471_RS02290 | Protein ID | WP_002323011.1 |
| Coordinates | 481458..481688 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH471_RS02265 (OH471_02265) | 476824..478155 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| OH471_RS02270 (OH471_02270) | 478177..478803 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| OH471_RS02275 (OH471_02275) | 478986..479567 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| OH471_RS02280 (OH471_02280) | 480053..480628 | + | 576 | WP_002293673.1 | SOS response-associated peptidase family protein | - |
| OH471_RS02285 (OH471_02285) | 480833..481171 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| OH471_RS02290 (OH471_02290) | 481458..481688 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| OH471_RS02295 (OH471_02295) | 481688..482029 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OH471_RS02300 (OH471_02300) | 482879..483064 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| OH471_RS02305 (OH471_02305) | 483569..483763 | + | 195 | WP_002295146.1 | hypothetical protein | - |
| OH471_RS02310 (OH471_02310) | 483954..484203 | + | 250 | Protein_458 | transposase | - |
| OH471_RS02315 (OH471_02315) | 484447..485277 | - | 831 | Protein_459 | manganese catalase family protein | - |
| OH471_RS02320 (OH471_02320) | 485485..486819 | + | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T262077 WP_002286801.1 NZ_CP109758:481688-482029 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |