Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 135648..136387 | Replicon | plasmid p2017-45-131-01A_1 |
Accession | NZ_CP109755 | ||
Organism | Enterobacter roggenkampii strain 2017-45-131-01A |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A9E6WPH7 |
Locus tag | OI984_RS25205 | Protein ID | WP_013087269.1 |
Coordinates | 135902..136387 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A9E6WPN8 |
Locus tag | OI984_RS25200 | Protein ID | WP_007869691.1 |
Coordinates | 135648..135914 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI984_RS25180 (OI984_25180) | 131535..131777 | + | 243 | WP_008502222.1 | hypothetical protein | - |
OI984_RS25185 (OI984_25185) | 132111..132878 | + | 768 | WP_008502221.1 | TraX family protein | - |
OI984_RS25190 (OI984_25190) | 132900..133199 | - | 300 | WP_226840878.1 | DUF2767 family protein | - |
OI984_RS25195 (OI984_25195) | 133982..134995 | - | 1014 | WP_039265242.1 | plasmid replication initiator RepA | - |
OI984_RS25200 (OI984_25200) | 135648..135914 | + | 267 | WP_007869691.1 | DUF1778 domain-containing protein | Antitoxin |
OI984_RS25205 (OI984_25205) | 135902..136387 | + | 486 | WP_013087269.1 | GNAT family N-acetyltransferase | Toxin |
OI984_RS25210 (OI984_25210) | 136594..137939 | + | 1346 | Protein_157 | ISNCY family transposase | - |
OI984_RS25215 (OI984_25215) | 138034..138261 | - | 228 | Protein_158 | transposase | - |
OI984_RS25220 (OI984_25220) | 138543..139139 | - | 597 | Protein_159 | IS3-like element ISEc52 family transposase | - |
OI984_RS25225 (OI984_25225) | 139127..139207 | + | 81 | Protein_160 | hypothetical protein | - |
OI984_RS25230 (OI984_25230) | 139204..139530 | + | 327 | Protein_161 | helix-turn-helix domain-containing protein | - |
OI984_RS25235 (OI984_25235) | 139680..140660 | - | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cheD | 1..197426 | 197426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17736.45 Da Isoelectric Point: 9.5181
>T262075 WP_013087269.1 NZ_CP109755:135902-136387 [Enterobacter roggenkampii]
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|