Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3437942..3438599 | Replicon | chromosome |
| Accession | NZ_CP109753 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-131-01A | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | OI984_RS16875 | Protein ID | WP_021242050.1 |
| Coordinates | 3438189..3438599 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | OI984_RS16870 | Protein ID | WP_006178375.1 |
| Coordinates | 3437942..3438208 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI984_RS16850 (OI984_16845) | 3433376..3434809 | - | 1434 | WP_008499715.1 | 6-phospho-beta-glucosidase BglA | - |
| OI984_RS16855 (OI984_16850) | 3434926..3435657 | - | 732 | WP_021242053.1 | MurR/RpiR family transcriptional regulator | - |
| OI984_RS16860 (OI984_16855) | 3435923..3436582 | + | 660 | WP_021242052.1 | hemolysin III family protein | - |
| OI984_RS16865 (OI984_16860) | 3436667..3437647 | - | 981 | WP_045351721.1 | tRNA-modifying protein YgfZ | - |
| OI984_RS16870 (OI984_16865) | 3437942..3438208 | + | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| OI984_RS16875 (OI984_16870) | 3438189..3438599 | + | 411 | WP_021242050.1 | protein YgfX | Toxin |
| OI984_RS16880 (OI984_16875) | 3438606..3439127 | - | 522 | WP_008499710.1 | flavodoxin FldB | - |
| OI984_RS16885 (OI984_16880) | 3439229..3440125 | + | 897 | WP_045351722.1 | site-specific tyrosine recombinase XerD | - |
| OI984_RS16890 (OI984_16885) | 3440154..3440867 | + | 714 | WP_008499708.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OI984_RS16895 (OI984_16890) | 3440873..3442606 | + | 1734 | WP_045351724.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T262070 WP_021242050.1 NZ_CP109753:3438189-3438599 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7NX65 |