Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 1958066..1958642 | Replicon | chromosome |
| Accession | NZ_CP109753 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-131-01A | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A656ULU9 |
| Locus tag | OI984_RS09665 | Protein ID | WP_025912099.1 |
| Coordinates | 1958355..1958642 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A7D6YIG8 |
| Locus tag | OI984_RS09660 | Protein ID | WP_025912101.1 |
| Coordinates | 1958066..1958368 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI984_RS09635 (OI984_09635) | 1954173..1954718 | + | 546 | WP_008501313.1 | YfaZ family outer membrane protein | - |
| OI984_RS09640 (OI984_09640) | 1954718..1955038 | + | 321 | WP_008501314.1 | hypothetical protein | - |
| OI984_RS09645 (OI984_09645) | 1955084..1956454 | - | 1371 | WP_045353156.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| OI984_RS09650 (OI984_09650) | 1956606..1957349 | + | 744 | WP_045353155.1 | AraC family transcriptional regulator | - |
| OI984_RS09655 (OI984_09655) | 1957397..1958035 | + | 639 | WP_045353154.1 | LysE family translocator | - |
| OI984_RS09660 (OI984_09660) | 1958066..1958368 | - | 303 | WP_025912101.1 | BrnA antitoxin family protein | Antitoxin |
| OI984_RS09665 (OI984_09665) | 1958355..1958642 | - | 288 | WP_025912099.1 | BrnT family toxin | Toxin |
| OI984_RS09670 (OI984_09670) | 1958811..1960082 | + | 1272 | WP_045353153.1 | DUF445 domain-containing protein | - |
| OI984_RS09675 (OI984_09675) | 1960079..1961155 | - | 1077 | WP_032655052.1 | DUF2955 domain-containing protein | - |
| OI984_RS09680 (OI984_09680) | 1961145..1962212 | - | 1068 | WP_025912094.1 | HlyD family secretion protein | - |
| OI984_RS09685 (OI984_09685) | 1962209..1962679 | - | 471 | WP_021240623.1 | MarR family transcriptional regulator | - |
| OI984_RS09690 (OI984_09690) | 1962825..1963290 | - | 466 | Protein_1904 | winged helix-turn-helix domain-containing protein | - |
| OI984_RS09695 (OI984_09695) | 1963283..1963399 | - | 117 | Protein_1905 | amino acid-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11235.68 Da Isoelectric Point: 7.4007
>T262067 WP_025912099.1 NZ_CP109753:c1958642-1958355 [Enterobacter roggenkampii]
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ULU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D6YIG8 |