Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1440470..1441090 | Replicon | chromosome |
| Accession | NZ_CP109753 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-131-01A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | OI984_RS07085 | Protein ID | WP_008499287.1 |
| Coordinates | 1440872..1441090 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | OI984_RS07080 | Protein ID | WP_008499288.1 |
| Coordinates | 1440470..1440844 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI984_RS07070 (OI984_07070) | 1435598..1436791 | + | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OI984_RS07075 (OI984_07075) | 1436814..1439960 | + | 3147 | WP_045352698.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OI984_RS07080 (OI984_07080) | 1440470..1440844 | + | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| OI984_RS07085 (OI984_07085) | 1440872..1441090 | + | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| OI984_RS07090 (OI984_07090) | 1441297..1441848 | + | 552 | WP_008499286.1 | maltose O-acetyltransferase | - |
| OI984_RS07095 (OI984_07095) | 1441966..1442433 | + | 468 | WP_008499285.1 | YlaC family protein | - |
| OI984_RS07100 (OI984_07100) | 1442405..1443865 | - | 1461 | WP_045352700.1 | PLP-dependent aminotransferase family protein | - |
| OI984_RS07105 (OI984_07105) | 1443967..1444677 | + | 711 | WP_045352701.1 | GNAT family protein | - |
| OI984_RS07110 (OI984_07110) | 1444674..1444814 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| OI984_RS07115 (OI984_07115) | 1444817..1445077 | - | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T262066 WP_008499287.1 NZ_CP109753:1440872-1441090 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT262066 WP_008499288.1 NZ_CP109753:1440470-1440844 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8SI38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |