Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 788358..789155 | Replicon | chromosome |
Accession | NZ_CP109753 | ||
Organism | Enterobacter roggenkampii strain 2017-45-131-01A |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | OI984_RS04000 | Protein ID | WP_045352937.1 |
Coordinates | 788358..788879 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | W7PG43 |
Locus tag | OI984_RS04005 | Protein ID | WP_008499829.1 |
Coordinates | 788886..789155 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI984_RS03970 (OI984_03975) | 783941..784630 | + | 690 | WP_045352931.1 | pyrimidine utilization protein B | - |
OI984_RS03975 (OI984_03980) | 784642..785028 | + | 387 | WP_008499822.1 | pyrimidine utilization protein C | - |
OI984_RS03980 (OI984_03985) | 785036..785836 | + | 801 | WP_045352934.1 | pyrimidine utilization protein D | - |
OI984_RS03985 (OI984_03990) | 785846..786436 | + | 591 | WP_025912982.1 | malonic semialdehyde reductase | - |
OI984_RS03990 (OI984_03995) | 786446..786940 | + | 495 | WP_023292823.1 | pyrimidine utilization flavin reductase protein F | - |
OI984_RS03995 (OI984_04000) | 786962..788284 | + | 1323 | WP_045352935.1 | pyrimidine utilization transport protein G | - |
OI984_RS04000 (OI984_04005) | 788358..788879 | - | 522 | WP_045352937.1 | GNAT family N-acetyltransferase | Toxin |
OI984_RS04005 (OI984_04010) | 788886..789155 | - | 270 | WP_008499829.1 | DUF1778 domain-containing protein | Antitoxin |
OI984_RS04010 (OI984_04015) | 789217..790134 | - | 918 | WP_025912980.1 | DMT family transporter | - |
OI984_RS04015 (OI984_04020) | 790254..790424 | - | 171 | WP_013097201.1 | general stress protein | - |
OI984_RS04020 (OI984_04025) | 790816..791412 | + | 597 | WP_008499831.1 | NAD(P)H:quinone oxidoreductase | - |
OI984_RS04025 (OI984_04030) | 791433..791660 | + | 228 | WP_008499832.1 | YccJ family protein | - |
OI984_RS04030 (OI984_04035) | 791756..792433 | - | 678 | Protein_800 | contractile injection system protein, VgrG/Pvc8 family | - |
OI984_RS04035 (OI984_04040) | 792434..792808 | - | 375 | WP_241771487.1 | Imm52 family immunity protein | - |
OI984_RS04040 (OI984_04045) | 793193..793531 | - | 339 | WP_241771488.1 | Tox-REase-5 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19628.37 Da Isoelectric Point: 7.4313
>T262064 WP_045352937.1 NZ_CP109753:c788879-788358 [Enterobacter roggenkampii]
VDNLTIEMFSEGKDYDFRGFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAIHKDLQGLEWGTTLVTHAMRVAYLASQAVGVHGIFVDALNDQAKQFYLKQGFIPLTDENSHSLF
FPTKSIERLFEQA
VDNLTIEMFSEGKDYDFRGFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAIHKDLQGLEWGTTLVTHAMRVAYLASQAVGVHGIFVDALNDQAKQFYLKQGFIPLTDENSHSLF
FPTKSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|