Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 238383..238960 Replicon plasmid p2017-45-163_1
Accession NZ_CP109745
Organism Citrobacter portucalensis strain 2017-45-163

Toxin (Protein)


Gene name parE Uniprot ID I3W245
Locus tag OI981_RS26420 Protein ID WP_015059150.1
Coordinates 238383..238694 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID E3DB50
Locus tag OI981_RS26425 Protein ID WP_014542884.1
Coordinates 238682..238960 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI981_RS26375 (OI981_26370) 233611..233847 + 237 WP_001087807.1 broad-spectrum mercury transporter MerE -
OI981_RS26380 (OI981_26375) 233913..234125 + 213 WP_000993245.1 DUF3330 domain-containing protein -
OI981_RS26385 (OI981_26380) 234255..234812 + 558 WP_001162010.1 recombinase family protein -
OI981_RS26390 (OI981_26385) 234897..235601 + 705 WP_023312637.1 IS6-like element IS26 family transposase -
OI981_RS26395 (OI981_26390) 235871..236476 + 606 WP_000509966.1 recombinase family protein -
OI981_RS26400 (OI981_26395) 236492..236713 - 222 WP_103468677.1 hypothetical protein -
OI981_RS26405 (OI981_26400) 236761..237252 + 492 WP_015059161.1 MbeB family mobilization protein -
OI981_RS26410 (OI981_26405) 237259..237474 + 216 WP_032634148.1 MbeD family mobilization/exclusion protein -
OI981_RS26415 (OI981_26410) 237581..238012 - 432 WP_048234297.1 hypothetical protein -
OI981_RS26420 (OI981_26415) 238383..238694 - 312 WP_015059150.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OI981_RS26425 (OI981_26420) 238682..238960 - 279 WP_014542884.1 CopG family ribbon-helix-helix protein Antitoxin
OI981_RS26430 (OI981_26425) 239635..240129 - 495 WP_021243016.1 peptide-methionine (S)-S-oxide reductase MsrA -
OI981_RS26435 (OI981_26430) 240119..240580 - 462 WP_021243015.1 peptide-methionine (R)-S-oxide reductase MsrB -
OI981_RS26440 (OI981_26435) 240604..240741 - 138 WP_021243014.1 hypothetical protein -
OI981_RS26445 (OI981_26440) 240815..241321 - 507 WP_001567380.1 DUF417 family protein -
OI981_RS26450 (OI981_26445) 241352..241612 - 261 WP_001567381.1 DUF1471 domain-containing protein -
OI981_RS26455 (OI981_26450) 241824..242381 - 558 WP_001567382.1 TetR/AcrR family transcriptional regulator -
OI981_RS26460 (OI981_26455) 242478..242744 - 267 WP_001567383.1 DUF1471 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..256885 256885


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-96)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 11840.74 Da        Isoelectric Point: 9.8620

>T262062 WP_015059150.1 NZ_CP109745:c238694-238383 [Citrobacter portucalensis]
MPQVIVSALAQRDLQRLQDFLKTKNRLAARKAGEVIIRAIQQLKTQPDMGRPVSLLPLEYQELVIGFGDSGYVMLYRHDR
ETDRIVILTVRHQKEAGYHGLQE

Download         Length: 312 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10721.74 Da        Isoelectric Point: 4.6216

>AT262062 WP_014542884.1 NZ_CP109745:c238960-238682 [Citrobacter portucalensis]
MSAATSIRLDDELKDRLKTLADDRHRSAHALMLEAITEYIDREEKRSQYLRDGQAAWQHYQETGLHLSAEEVEAWIDTWG
TENEQDAPPCHR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P6WJV0

Antitoxin

Source ID Structure
AlphaFold DB E3DB50

References