Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 56876..57426 | Replicon | plasmid p2017-45-163_1 |
| Accession | NZ_CP109745 | ||
| Organism | Citrobacter portucalensis strain 2017-45-163 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1EZ93 |
| Locus tag | OI981_RS25325 | Protein ID | WP_007372286.1 |
| Coordinates | 56876..57184 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1FMC3 |
| Locus tag | OI981_RS25330 | Protein ID | WP_007372285.1 |
| Coordinates | 57187..57426 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI981_RS25280 (OI981_25275) | 51958..52401 | - | 444 | WP_007372295.1 | hypothetical protein | - |
| OI981_RS25285 (OI981_25280) | 52639..52977 | + | 339 | WP_284634362.1 | hypothetical protein | - |
| OI981_RS25290 (OI981_25285) | 53340..53666 | - | 327 | WP_007372293.1 | hypothetical protein | - |
| OI981_RS25295 (OI981_25290) | 53750..54148 | - | 399 | WP_007372292.1 | hypothetical protein | - |
| OI981_RS25300 (OI981_25295) | 54159..54446 | - | 288 | WP_016241556.1 | hypothetical protein | - |
| OI981_RS25305 (OI981_25300) | 54748..55278 | - | 531 | WP_020996213.1 | HAD domain-containing protein | - |
| OI981_RS25310 (OI981_25305) | 55301..55918 | - | 618 | WP_007372289.1 | hypothetical protein | - |
| OI981_RS25315 (OI981_25310) | 55988..56542 | - | 555 | WP_007372288.1 | hypothetical protein | - |
| OI981_RS25320 (OI981_25315) | 56697..56855 | - | 159 | WP_016241558.1 | hypothetical protein | - |
| OI981_RS25325 (OI981_25320) | 56876..57184 | - | 309 | WP_007372286.1 | CcdB family protein | Toxin |
| OI981_RS25330 (OI981_25325) | 57187..57426 | - | 240 | WP_007372285.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| OI981_RS25335 (OI981_25330) | 57565..58029 | - | 465 | WP_008786596.1 | hypothetical protein | - |
| OI981_RS25340 (OI981_25335) | 58026..58700 | - | 675 | WP_008786597.1 | hypothetical protein | - |
| OI981_RS25345 (OI981_25340) | 59158..59790 | - | 633 | WP_007372282.1 | hypothetical protein | - |
| OI981_RS25350 (OI981_25345) | 59806..59946 | - | 141 | WP_007372281.1 | hypothetical protein | - |
| OI981_RS25355 (OI981_25350) | 60094..60552 | - | 459 | WP_008786599.1 | hypothetical protein | - |
| OI981_RS25360 (OI981_25355) | 60605..60802 | - | 198 | WP_032155220.1 | Lar family restriction alleviation protein | - |
| OI981_RS25365 (OI981_25360) | 60825..61520 | - | 696 | WP_007372278.1 | hypothetical protein | - |
| OI981_RS25370 (OI981_25365) | 61651..61842 | - | 192 | WP_016241560.1 | hypothetical protein | - |
| OI981_RS25375 (OI981_25370) | 62024..62419 | - | 396 | WP_024196081.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..256885 | 256885 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11351.17 Da Isoelectric Point: 8.5044
>T262061 WP_007372286.1 NZ_CP109745:c57184-56876 [Citrobacter portucalensis]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|