Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 49226..50127 Replicon plasmid p2017-45-163_1
Accession NZ_CP109745
Organism Citrobacter portucalensis strain 2017-45-163

Toxin (Protein)


Gene name - Uniprot ID S1EZ83
Locus tag OI981_RS25255 Protein ID WP_008786589.1
Coordinates 49669..50127 (+) Length 153 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag OI981_RS25250 Protein ID WP_008786588.1
Coordinates 49226..49672 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI981_RS25215 (OI981_25210) 44589..44840 - 252 WP_024196080.1 hypothetical protein -
OI981_RS25220 (OI981_25215) 45262..46104 - 843 WP_007372307.1 HNH endonuclease signature motif containing protein -
OI981_RS25225 (OI981_25220) 46672..46836 - 165 WP_007372306.1 hypothetical protein -
OI981_RS25230 (OI981_25225) 47123..47566 - 444 WP_007372305.1 hypothetical protein -
OI981_RS25235 (OI981_25230) 47626..47904 - 279 WP_007372304.1 hypothetical protein -
OI981_RS25240 (OI981_25235) 47876..48718 - 843 WP_007372303.1 hypothetical protein -
OI981_RS25245 (OI981_25240) 48760..49077 - 318 WP_016241555.1 hypothetical protein -
OI981_RS25250 (OI981_25245) 49226..49672 + 447 WP_008786588.1 DUF2384 domain-containing protein Antitoxin
OI981_RS25255 (OI981_25250) 49669..50127 + 459 WP_008786589.1 RES family NAD+ phosphorylase Toxin
OI981_RS25260 (OI981_25255) 50171..50401 + 231 WP_007372299.1 hypothetical protein -
OI981_RS25265 (OI981_25260) 50469..50735 - 267 WP_007372298.1 hypothetical protein -
OI981_RS25270 (OI981_25265) 50785..51339 - 555 WP_284634361.1 hypothetical protein -
OI981_RS25275 (OI981_25270) 51498..51839 - 342 WP_007372296.1 hypothetical protein -
OI981_RS25280 (OI981_25275) 51958..52401 - 444 WP_007372295.1 hypothetical protein -
OI981_RS25285 (OI981_25280) 52639..52977 + 339 WP_284634362.1 hypothetical protein -
OI981_RS25290 (OI981_25285) 53340..53666 - 327 WP_007372293.1 hypothetical protein -
OI981_RS25295 (OI981_25290) 53750..54148 - 399 WP_007372292.1 hypothetical protein -
OI981_RS25300 (OI981_25295) 54159..54446 - 288 WP_016241556.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..256885 256885


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre/MbcA/ParS-like, toxin-binding domain

(95-145)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 17005.43 Da        Isoelectric Point: 4.5730

>T262060 WP_008786589.1 NZ_CP109745:49669-50127 [Citrobacter portucalensis]
VILYRLTKTRYLMTAWSGLGAKETGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK

Download         Length: 459 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16689.02 Da        Isoelectric Point: 6.9812

>AT262060 WP_008786588.1 NZ_CP109745:49226-49672 [Citrobacter portucalensis]
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ83

Antitoxin

Source ID Structure

References