Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2085591..2086245 | Replicon | chromosome |
Accession | NZ_CP109744 | ||
Organism | Citrobacter portucalensis strain 2017-45-163 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OI981_RS10030 | Protein ID | WP_003825515.1 |
Coordinates | 2085838..2086245 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | OI981_RS10025 | Protein ID | WP_003825514.1 |
Coordinates | 2085591..2085857 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI981_RS10000 (OI981_09995) | 2080746..2082179 | - | 1434 | WP_060683276.1 | 6-phospho-beta-glucosidase BglA | - |
OI981_RS10005 (OI981_10000) | 2082300..2083028 | - | 729 | WP_008785744.1 | MurR/RpiR family transcriptional regulator | - |
OI981_RS10010 (OI981_10005) | 2083081..2083392 | + | 312 | WP_048225466.1 | N(4)-acetylcytidine aminohydrolase | - |
OI981_RS10015 (OI981_10010) | 2083556..2084218 | + | 663 | WP_060683277.1 | hemolysin III family protein | - |
OI981_RS10020 (OI981_10015) | 2084350..2085333 | - | 984 | WP_060683278.1 | tRNA-modifying protein YgfZ | - |
OI981_RS10025 (OI981_10020) | 2085591..2085857 | + | 267 | WP_003825514.1 | FAD assembly factor SdhE | Antitoxin |
OI981_RS10030 (OI981_10025) | 2085838..2086245 | + | 408 | WP_003825515.1 | protein YgfX | Toxin |
OI981_RS10035 (OI981_10030) | 2086347..2086868 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
OI981_RS10040 (OI981_10035) | 2086982..2087878 | + | 897 | WP_003825519.1 | site-specific tyrosine recombinase XerD | - |
OI981_RS10045 (OI981_10040) | 2087902..2088612 | + | 711 | WP_060683280.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OI981_RS10050 (OI981_10045) | 2088618..2090351 | + | 1734 | WP_048215591.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15882.76 Da Isoelectric Point: 11.3523
>T262053 WP_003825515.1 NZ_CP109744:2085838-2086245 [Citrobacter portucalensis]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|