Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1480159..1480747 | Replicon | chromosome |
Accession | NZ_CP109744 | ||
Organism | Citrobacter portucalensis strain 2017-45-163 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OI981_RS07085 | Protein ID | WP_060683076.1 |
Coordinates | 1480430..1480747 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A5B0STC7 |
Locus tag | OI981_RS07080 | Protein ID | WP_032942057.1 |
Coordinates | 1480159..1480437 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI981_RS07070 (OI981_07070) | 1477612..1479243 | + | 1632 | WP_003826514.1 | Na/Pi cotransporter family protein | - |
OI981_RS07075 (OI981_07075) | 1479359..1480048 | - | 690 | WP_060683075.1 | dipeptidase PepE | - |
OI981_RS07080 (OI981_07080) | 1480159..1480437 | - | 279 | WP_032942057.1 | putative addiction module antidote protein | Antitoxin |
OI981_RS07085 (OI981_07085) | 1480430..1480747 | - | 318 | WP_060683076.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OI981_RS07090 (OI981_07090) | 1481011..1481562 | - | 552 | WP_060683077.1 | AAA family ATPase | - |
OI981_RS07095 (OI981_07095) | 1481817..1481999 | + | 183 | WP_225623038.1 | hypothetical protein | - |
OI981_RS07100 (OI981_07100) | 1482049..1482861 | - | 813 | WP_060683079.1 | shikimate 5-dehydrogenase | - |
OI981_RS07105 (OI981_07105) | 1482863..1484086 | - | 1224 | WP_060683080.1 | L-sorbose 1-phosphate reductase | - |
OI981_RS07110 (OI981_07110) | 1484155..1484979 | - | 825 | WP_060683081.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11959.93 Da Isoelectric Point: 9.2299
>T262050 WP_060683076.1 NZ_CP109744:c1480747-1480430 [Citrobacter portucalensis]
IMEILQTMVFQRWEHNLRDRRAKTLIATRLFRLANGLAGDVKPVGEGVSEMRISYGPGYRIYFKQQGCRIIILLCGGDKS
SQANDITLAKMLARTLDSQEVFCHE
IMEILQTMVFQRWEHNLRDRRAKTLIATRLFRLANGLAGDVKPVGEGVSEMRISYGPGYRIYFKQQGCRIIILLCGGDKS
SQANDITLAKMLARTLDSQEVFCHE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|