Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 1078800..1079480 Replicon chromosome
Accession NZ_CP109744
Organism Citrobacter portucalensis strain 2017-45-163

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag OI981_RS05160 Protein ID WP_039026306.1
Coordinates 1079139..1079480 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag OI981_RS05155 Protein ID WP_039026307.1
Coordinates 1078800..1079117 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI981_RS05115 (OI981_05115) 1073907..1074731 + 825 WP_039026313.1 DUF932 domain-containing protein -
OI981_RS05120 (OI981_05120) 1074940..1075638 + 699 WP_039026312.1 DeoR family transcriptional regulator -
OI981_RS05125 (OI981_05125) 1075966..1076181 + 216 WP_039026311.1 hypothetical protein -
OI981_RS05130 (OI981_05130) 1076391..1077167 + 777 WP_191226893.1 Ivy family c-type lysozyme inhibitor -
OI981_RS05135 (OI981_05135) 1077263..1077487 + 225 WP_039026310.1 DUF905 domain-containing protein -
OI981_RS05140 (OI981_05140) 1077602..1078060 + 459 WP_039026309.1 antirestriction protein -
OI981_RS05145 (OI981_05145) 1078076..1078552 + 477 WP_039026308.1 RadC family protein -
OI981_RS05150 (OI981_05150) 1078561..1078782 + 222 WP_000691995.1 DUF987 domain-containing protein -
OI981_RS05155 (OI981_05155) 1078800..1079117 + 318 WP_039026307.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OI981_RS05160 (OI981_05160) 1079139..1079480 + 342 WP_039026306.1 TA system toxin CbtA family protein Toxin
OI981_RS05165 (OI981_05165) 1079596..1080429 + 834 WP_284634099.1 DUF4942 domain-containing protein -
OI981_RS05170 (OI981_05170) 1080899..1081465 + 567 WP_060682980.1 hypothetical protein -
OI981_RS05175 (OI981_05175) 1081474..1081668 - 195 WP_008786495.1 toxin-antitoxin system HicB family antitoxin -
OI981_RS05180 (OI981_05180) 1081805..1082095 + 291 WP_060682981.1 SymE family type I addiction module toxin -
OI981_RS05185 (OI981_05185) 1082434..1082694 + 261 WP_008786497.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OI981_RS05190 (OI981_05190) 1082698..1083000 + 303 WP_071845242.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1061706..1083000 21294


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12825.82 Da        Isoelectric Point: 9.7153

>T262047 WP_039026306.1 NZ_CP109744:1079139-1079480 [Citrobacter portucalensis]
MKTLPATISRAAKPCLSTVAVWQMLLTRLLEQHYGLTLNDTPFSDVTVIQEHINAGITLADAVNFLVEKYELVRIDRRSF
NCQEQSPYIRAVDILRARQATGLLRQSRNNAVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11891.45 Da        Isoelectric Point: 6.9456

>AT262047 WP_039026307.1 NZ_CP109744:1078800-1079117 [Citrobacter portucalensis]
MSNTTWGLQRDITPRMGARLVQEGNRLHYLADRASITSKFSDAECQKLDIAFPHFISQMESMLTTGEMNPRHAHCVTLYH
NGYTCEADTLGSCGYVYIAVYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References