Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3673800..3674431 | Replicon | chromosome |
| Accession | NZ_CP109739 | ||
| Organism | Serratia nevei strain 2017-45-174 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OI978_RS17575 | Protein ID | WP_055313518.1 |
| Coordinates | 3674033..3674431 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0G3SVC2 |
| Locus tag | OI978_RS17570 | Protein ID | WP_047730457.1 |
| Coordinates | 3673800..3674033 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI978_RS17545 (OI978_17540) | 3668952..3670568 | + | 1617 | WP_284594404.1 | methyl-accepting chemotaxis protein | - |
| OI978_RS17550 (OI978_17545) | 3670606..3671478 | + | 873 | WP_025159837.1 | protein-glutamate O-methyltransferase CheR | - |
| OI978_RS17555 (OI978_17550) | 3671478..3672527 | + | 1050 | WP_284594405.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| OI978_RS17560 (OI978_17555) | 3672630..3673019 | + | 390 | WP_004934862.1 | chemotaxis response regulator CheY | - |
| OI978_RS17565 (OI978_17560) | 3673030..3673674 | + | 645 | WP_004934858.1 | protein phosphatase CheZ | - |
| OI978_RS17570 (OI978_17565) | 3673800..3674033 | + | 234 | WP_047730457.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OI978_RS17575 (OI978_17570) | 3674033..3674431 | + | 399 | WP_055313518.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OI978_RS17580 (OI978_17575) | 3674558..3675709 | + | 1152 | WP_047730459.1 | flagellar biosynthesis protein FlhB | - |
| OI978_RS17585 (OI978_17580) | 3675702..3677780 | + | 2079 | WP_038876828.1 | flagellar biosynthesis protein FlhA | - |
| OI978_RS17590 (OI978_17585) | 3677780..3678184 | + | 405 | WP_047730460.1 | flagellar protein FlhE | - |
| OI978_RS17595 (OI978_17590) | 3678513..3679328 | + | 816 | WP_055316342.1 | 5'-nucleotidase, lipoprotein e(P4) family | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14932.09 Da Isoelectric Point: 7.4664
>T262042 WP_055313518.1 NZ_CP109739:3674033-3674431 [Serratia nevei]
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSITYGELVHGVENSARPAVNARVVEDFVSRLDILDYSAKAASHY
GNIRAVLERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVEGLRLENWL
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSITYGELVHGVENSARPAVNARVVEDFVSRLDILDYSAKAASHY
GNIRAVLERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVEGLRLENWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|