Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2919777..2920433 | Replicon | chromosome |
| Accession | NZ_CP109739 | ||
| Organism | Serratia nevei strain 2017-45-174 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A5C7DE55 |
| Locus tag | OI978_RS14085 | Protein ID | WP_047730091.1 |
| Coordinates | 2920044..2920433 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
| Locus tag | OI978_RS14080 | Protein ID | WP_004941563.1 |
| Coordinates | 2919777..2920040 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI978_RS14065 (OI978_14060) | 2916067..2916978 | - | 912 | WP_284593742.1 | lipid kinase YegS | - |
| OI978_RS14070 (OI978_14065) | 2917446..2918798 | - | 1353 | WP_038873761.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
| OI978_RS14075 (OI978_14070) | 2919100..2919438 | - | 339 | WP_038873760.1 | YegP family protein | - |
| OI978_RS14080 (OI978_14075) | 2919777..2920040 | + | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OI978_RS14085 (OI978_14080) | 2920044..2920433 | + | 390 | WP_047730091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OI978_RS14090 (OI978_14085) | 2920438..2921154 | - | 717 | WP_047730092.1 | two-component system response regulator BaeR | - |
| OI978_RS14095 (OI978_14090) | 2921164..2922537 | - | 1374 | WP_047730093.1 | two-component system sensor histidine kinase BaeS | - |
| OI978_RS14100 (OI978_14095) | 2922534..2923964 | - | 1431 | WP_047730094.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14337.57 Da Isoelectric Point: 7.8794
>T262040 WP_047730091.1 NZ_CP109739:2920044-2920433 [Serratia nevei]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|