Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2398216..2398885 | Replicon | chromosome |
| Accession | NZ_CP109739 | ||
| Organism | Serratia nevei strain 2017-45-174 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A5P6GZ53 |
| Locus tag | OI978_RS11410 | Protein ID | WP_047729923.1 |
| Coordinates | 2398463..2398885 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8B4GS04 |
| Locus tag | OI978_RS11405 | Protein ID | WP_019455657.1 |
| Coordinates | 2398216..2398482 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI978_RS11380 (OI978_11375) | 2393791..2394717 | + | 927 | WP_047729921.1 | ribokinase | - |
| OI978_RS11385 (OI978_11380) | 2394750..2395358 | - | 609 | WP_025304127.1 | HD domain-containing protein | - |
| OI978_RS11390 (OI978_11385) | 2395542..2396216 | + | 675 | WP_038871224.1 | hemolysin III family protein | - |
| OI978_RS11395 (OI978_11390) | 2396367..2396864 | + | 498 | WP_038871226.1 | DUF2165 domain-containing protein | - |
| OI978_RS11400 (OI978_11395) | 2396903..2397895 | - | 993 | WP_047729922.1 | tRNA-modifying protein YgfZ | - |
| OI978_RS11405 (OI978_11400) | 2398216..2398482 | + | 267 | WP_019455657.1 | FAD assembly factor SdhE | Antitoxin |
| OI978_RS11410 (OI978_11405) | 2398463..2398885 | + | 423 | WP_047729923.1 | protein YgfX | Toxin |
| OI978_RS11415 (OI978_11410) | 2398885..2399580 | + | 696 | WP_055316660.1 | two-component system response regulator CreB | - |
| OI978_RS11420 (OI978_11415) | 2399577..2400995 | + | 1419 | WP_055316662.1 | two-component system sensor histidine kinase CreC | - |
| OI978_RS11425 (OI978_11420) | 2401076..2402440 | + | 1365 | WP_047729926.1 | cell envelope integrity protein CreD | - |
| OI978_RS11430 (OI978_11425) | 2402477..2402995 | - | 519 | WP_038871234.1 | flavodoxin FldB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16500.57 Da Isoelectric Point: 10.8114
>T262038 WP_047729923.1 NZ_CP109739:2398463-2398885 [Serratia nevei]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPTEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPVGDGEEA
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPTEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPVGDGEEA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5P6GZ53 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GS04 |