Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 1333492..1334093 | Replicon | chromosome |
| Accession | NZ_CP109739 | ||
| Organism | Serratia nevei strain 2017-45-174 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OI978_RS06365 | Protein ID | WP_033636540.1 |
| Coordinates | 1333713..1334093 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0G3SPC0 |
| Locus tag | OI978_RS06360 | Protein ID | WP_038875999.1 |
| Coordinates | 1333492..1333713 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI978_RS06340 (OI978_06335) | 1328641..1329618 | + | 978 | WP_016929588.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| OI978_RS06345 (OI978_06340) | 1329620..1329772 | - | 153 | WP_168166338.1 | hypothetical protein | - |
| OI978_RS06350 (OI978_06345) | 1329968..1332031 | + | 2064 | WP_284597311.1 | alpha-amylase | - |
| OI978_RS06355 (OI978_06350) | 1332167..1333417 | + | 1251 | WP_004933935.1 | valine--pyruvate transaminase | - |
| OI978_RS06360 (OI978_06355) | 1333492..1333713 | + | 222 | WP_038875999.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| OI978_RS06365 (OI978_06360) | 1333713..1334093 | + | 381 | WP_033636540.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OI978_RS06370 (OI978_06365) | 1334104..1335762 | - | 1659 | WP_047729572.1 | putative transporter | - |
| OI978_RS06375 (OI978_06370) | 1335930..1336358 | - | 429 | WP_004933922.1 | small heat shock chaperone IbpB | - |
| OI978_RS06380 (OI978_06375) | 1336459..1336872 | - | 414 | WP_004933919.1 | small heat shock chaperone IbpA | - |
| OI978_RS06385 (OI978_06380) | 1337182..1337529 | + | 348 | WP_016929593.1 | YceK/YidQ family lipoprotein | - |
| OI978_RS06390 (OI978_06385) | 1337560..1338840 | - | 1281 | WP_047729573.1 | DUF3748 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14185.53 Da Isoelectric Point: 7.3170
>T262037 WP_033636540.1 NZ_CP109739:1333713-1334093 [Serratia nevei]
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|