Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 264392..265014 Replicon chromosome
Accession NZ_CP109739
Organism Serratia nevei strain 2017-45-174

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag OI978_RS01325 Protein ID WP_004940313.1
Coordinates 264811..265014 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag OI978_RS01320 Protein ID WP_004940312.1
Coordinates 264392..264760 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI978_RS01290 (OI978_01290) 260485..260739 + 255 WP_038874985.1 type B 50S ribosomal protein L31 -
OI978_RS01295 (OI978_01295) 260752..260892 + 141 WP_004940304.1 type B 50S ribosomal protein L36 -
OI978_RS01300 (OI978_01300) 260999..261877 - 879 WP_038874983.1 zinc ABC transporter substrate-binding protein -
OI978_RS01305 (OI978_01305) 261903..262760 - 858 WP_038874980.1 metal ABC transporter permease -
OI978_RS01310 (OI978_01310) 262757..263470 - 714 WP_047728664.1 ABC transporter ATP-binding protein -
OI978_RS01315 (OI978_01315) 263880..264233 + 354 WP_038874974.1 hypothetical protein -
OI978_RS01320 (OI978_01320) 264392..264760 + 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
OI978_RS01325 (OI978_01325) 264811..265014 + 204 WP_004940313.1 HHA domain-containing protein Toxin
OI978_RS01330 (OI978_01330) 265298..265816 - 519 WP_047728667.1 cytochrome b/b6 domain-containing protein -
OI978_RS01335 (OI978_01335) 265869..267296 - 1428 WP_047728669.1 N-acetylglucosamine-binding protein GbpA -
OI978_RS01340 (OI978_01340) 267549..267911 + 363 WP_284596532.1 type II secretion system pilot lipoprotein GspS -
OI978_RS01345 (OI978_01345) 267908..268723 - 816 WP_284596534.1 prepilin peptidase -
OI978_RS01350 (OI978_01350) 268760..269206 - 447 WP_055316525.1 type II secretion system protein GspM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T262033 WP_004940313.1 NZ_CP109739:264811-265014 [Serratia nevei]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT262033 WP_004940312.1 NZ_CP109739:264392-264760 [Serratia nevei]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References