Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4209801..4210458 | Replicon | chromosome |
| Accession | NZ_CP109733 | ||
| Organism | Providencia thailandensis strain 2017-45-35 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7T1H2A7 |
| Locus tag | OI982_RS19700 | Protein ID | WP_036941148.1 |
| Coordinates | 4210048..4210458 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | B2Q1I8 |
| Locus tag | OI982_RS19695 | Protein ID | WP_004921708.1 |
| Coordinates | 4209801..4210067 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI982_RS19680 (OI982_19850) | 4204832..4207708 | + | 2877 | WP_141173656.1 | aminomethyl-transferring glycine dehydrogenase | - |
| OI982_RS19685 (OI982_19855) | 4207927..4208547 | - | 621 | WP_004921714.1 | HD domain-containing protein | - |
| OI982_RS19690 (OI982_19860) | 4208559..4209548 | - | 990 | WP_141173655.1 | tRNA-modifying protein YgfZ | - |
| OI982_RS19695 (OI982_19865) | 4209801..4210067 | + | 267 | WP_004921708.1 | FAD assembly factor SdhE | Antitoxin |
| OI982_RS19700 (OI982_19870) | 4210048..4210458 | + | 411 | WP_036941148.1 | protein YgfX | Toxin |
| OI982_RS19705 (OI982_19875) | 4210504..4211022 | - | 519 | WP_014656387.1 | flavodoxin FldB | - |
| OI982_RS19710 (OI982_19880) | 4211185..4212108 | + | 924 | WP_141173654.1 | site-specific tyrosine recombinase XerD | - |
| OI982_RS19715 (OI982_19885) | 4212128..4212832 | + | 705 | WP_141173653.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OI982_RS19720 (OI982_19890) | 4212838..4214571 | + | 1734 | WP_004921693.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15289.15 Da Isoelectric Point: 10.8779
>T262031 WP_036941148.1 NZ_CP109733:4210048-4210458 [Providencia thailandensis]
VVLWKSNLSISWKTQLFSTCAHGVVGFILLVAPWAPGNSMVWLPLLVIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWSIVKQPWCSRVGVLLTLSALQGKPQKIRLWVAKDALSEESWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCAHGVVGFILLVAPWAPGNSMVWLPLLVIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWSIVKQPWCSRVGVLLTLSALQGKPQKIRLWVAKDALSEESWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T1H2A7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140NIX0 |