Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3528083..3528733 | Replicon | chromosome |
Accession | NZ_CP109733 | ||
Organism | Providencia thailandensis strain 2017-45-35 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | OI982_RS16645 | Protein ID | WP_284659473.1 |
Coordinates | 3528083..3528286 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B2Q721 |
Locus tag | OI982_RS16650 | Protein ID | WP_004927067.1 |
Coordinates | 3528365..3528733 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI982_RS16620 (OI982_16770) | 3523964..3524302 | + | 339 | WP_004927053.1 | P-II family nitrogen regulator | - |
OI982_RS16625 (OI982_16775) | 3524313..3525596 | + | 1284 | WP_014656764.1 | ammonium transporter AmtB | - |
OI982_RS16630 (OI982_16780) | 3525833..3526699 | - | 867 | WP_284659472.1 | acyl-CoA thioesterase II | - |
OI982_RS16635 (OI982_16785) | 3527022..3527477 | + | 456 | WP_284659610.1 | YbaY family lipoprotein | - |
OI982_RS16645 (OI982_16795) | 3528083..3528286 | - | 204 | WP_284659473.1 | HHA domain-containing protein | Toxin |
OI982_RS16650 (OI982_16800) | 3528365..3528733 | - | 369 | WP_004927067.1 | Hha toxicity modulator TomB | Antitoxin |
OI982_RS16655 (OI982_16805) | 3529301..3530638 | - | 1338 | WP_004927077.1 | murein transglycosylase D | - |
OI982_RS16660 (OI982_16810) | 3530717..3531472 | - | 756 | WP_076914490.1 | hydroxyacylglutathione hydrolase | - |
OI982_RS16665 (OI982_16815) | 3531506..3532231 | + | 726 | WP_040132836.1 | class I SAM-dependent methyltransferase | - |
OI982_RS16670 (OI982_16820) | 3532310..3532780 | - | 471 | WP_014656762.1 | ribonuclease HI | - |
OI982_RS16675 (OI982_16825) | 3532835..3533596 | + | 762 | WP_004927092.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8101.45 Da Isoelectric Point: 6.9770
>T262030 WP_284659473.1 NZ_CP109733:c3528286-3528083 [Providencia thailandensis]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYLAADHRLAELTMNKLYDKIPASVWKFVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYLAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14149.01 Da Isoelectric Point: 4.2591
>AT262030 WP_004927067.1 NZ_CP109733:c3528733-3528365 [Providencia thailandensis]
MDEYSPKNYDISELKYLCNSLNREAMLSLQKTNTHWVNDLSSPQSARLNELIEHIAAFVWQFKIKYPKENLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVSVLDDDLKCPASKT
MDEYSPKNYDISELKYLCNSLNREAMLSLQKTNTHWVNDLSSPQSARLNELIEHIAAFVWQFKIKYPKENLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVSVLDDDLKCPASKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|