Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 77525..78264 | Replicon | plasmid p2017-45-51-04-01_2 |
Accession | NZ_CP109731 | ||
Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A9E6WPH7 |
Locus tag | OI980_RS26940 | Protein ID | WP_013087269.1 |
Coordinates | 77525..78010 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A9E6WPN8 |
Locus tag | OI980_RS26945 | Protein ID | WP_007869691.1 |
Coordinates | 77998..78264 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI980_RS26920 (OI980_26910) | 72577..73980 | - | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
OI980_RS26925 (OI980_26915) | 74222..75190 | - | 969 | WP_022652343.1 | IS5-like element IS903B family transposase | - |
OI980_RS26930 (OI980_26920) | 75265..75897 | + | 633 | WP_284608208.1 | hypothetical protein | - |
OI980_RS26935 (OI980_26925) | 75926..77329 | - | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
OI980_RS26940 (OI980_26930) | 77525..78010 | - | 486 | WP_013087269.1 | GNAT family N-acetyltransferase | Toxin |
OI980_RS26945 (OI980_26935) | 77998..78264 | - | 267 | WP_007869691.1 | DUF1778 domain-containing protein | Antitoxin |
OI980_RS26950 (OI980_26940) | 78917..79930 | + | 1014 | WP_039265242.1 | plasmid replication initiator RepA | - |
OI980_RS26955 (OI980_26945) | 80713..81012 | + | 300 | WP_226840878.1 | DUF2767 family protein | - |
OI980_RS26960 (OI980_26950) | 81034..81801 | - | 768 | WP_008502221.1 | TraX family protein | - |
OI980_RS26965 (OI980_26955) | 82135..82377 | - | 243 | WP_008502222.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cheD | 1..184755 | 184755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17736.45 Da Isoelectric Point: 9.5181
>T262028 WP_013087269.1 NZ_CP109731:c78010-77525 [Enterobacter roggenkampii]
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|