Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 56171..56697 | Replicon | plasmid p2017-45-51-04-01_1 |
Accession | NZ_CP109730 | ||
Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | OI980_RS25510 | Protein ID | WP_000323025.1 |
Coordinates | 56171..56458 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | OI980_RS25515 | Protein ID | WP_000534858.1 |
Coordinates | 56458..56697 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI980_RS25475 (OI980_25465) | 51741..51917 | - | 177 | WP_001371930.1 | hypothetical protein | - |
OI980_RS25480 (OI980_25470) | 52428..53372 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
OI980_RS25485 (OI980_25475) | 53468..54070 | + | 603 | WP_012695474.1 | hypothetical protein | - |
OI980_RS25490 (OI980_25480) | 54130..54480 | + | 351 | WP_000743059.1 | hypothetical protein | - |
OI980_RS25495 (OI980_25485) | 54527..54730 | + | 204 | WP_001015183.1 | hypothetical protein | - |
OI980_RS25500 (OI980_25490) | 55012..55332 | + | 321 | WP_000332796.1 | hypothetical protein | - |
OI980_RS25505 (OI980_25495) | 55945..56070 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
OI980_RS25510 (OI980_25500) | 56171..56458 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
OI980_RS25515 (OI980_25505) | 56458..56697 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
OI980_RS25520 (OI980_25510) | 56722..56826 | + | 105 | Protein_60 | protein YdfV | - |
OI980_RS25525 (OI980_25515) | 56960..57883 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
OI980_RS25530 (OI980_25520) | 58083..58655 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
OI980_RS25535 (OI980_25525) | 59131..60369 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(D) / blaTEM-1B / sul1 / qacE / ere(A) / aac(6')-IIc / mcr-9 | - | 1..256678 | 256678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T262026 WP_000323025.1 NZ_CP109730:c56458-56171 [Enterobacter roggenkampii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|