Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4752968..4753625 | Replicon | chromosome |
| Accession | NZ_CP109727 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | OI980_RS23030 | Protein ID | WP_021242050.1 |
| Coordinates | 4752968..4753378 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | OI980_RS23035 | Protein ID | WP_006178375.1 |
| Coordinates | 4753359..4753625 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI980_RS23010 (OI980_23005) | 4748961..4750694 | - | 1734 | WP_045351724.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OI980_RS23015 (OI980_23010) | 4750700..4751413 | - | 714 | WP_008499708.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OI980_RS23020 (OI980_23015) | 4751442..4752338 | - | 897 | WP_045351722.1 | site-specific tyrosine recombinase XerD | - |
| OI980_RS23025 (OI980_23020) | 4752440..4752961 | + | 522 | WP_008499710.1 | flavodoxin FldB | - |
| OI980_RS23030 (OI980_23025) | 4752968..4753378 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
| OI980_RS23035 (OI980_23030) | 4753359..4753625 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| OI980_RS23040 (OI980_23035) | 4753920..4754900 | + | 981 | WP_045351721.1 | tRNA-modifying protein YgfZ | - |
| OI980_RS23045 (OI980_23040) | 4754985..4755644 | - | 660 | WP_021242052.1 | hemolysin III family protein | - |
| OI980_RS23050 (OI980_23045) | 4755910..4756641 | + | 732 | WP_021242053.1 | MurR/RpiR family transcriptional regulator | - |
| OI980_RS23055 (OI980_23050) | 4756758..4758191 | + | 1434 | WP_008499715.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T262025 WP_021242050.1 NZ_CP109727:c4753378-4752968 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7NX65 |