Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 2323908..2324705 | Replicon | chromosome |
| Accession | NZ_CP109727 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | OI980_RS11110 | Protein ID | WP_045352937.1 |
| Coordinates | 2324184..2324705 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | W7PG43 |
| Locus tag | OI980_RS11105 | Protein ID | WP_008499829.1 |
| Coordinates | 2323908..2324177 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI980_RS11070 (OI980_11065) | 2319532..2319870 | + | 339 | WP_241771488.1 | Tox-REase-5 domain-containing protein | - |
| OI980_RS11075 (OI980_11070) | 2320255..2320629 | + | 375 | WP_241771487.1 | Imm52 family immunity protein | - |
| OI980_RS11080 (OI980_11075) | 2320630..2321307 | + | 678 | Protein_2143 | contractile injection system protein, VgrG/Pvc8 family | - |
| OI980_RS11085 (OI980_11080) | 2321403..2321630 | - | 228 | WP_008499832.1 | YccJ family protein | - |
| OI980_RS11090 (OI980_11085) | 2321651..2322247 | - | 597 | WP_008499831.1 | NAD(P)H:quinone oxidoreductase | - |
| OI980_RS11095 (OI980_11090) | 2322639..2322809 | + | 171 | WP_013097201.1 | general stress protein | - |
| OI980_RS11100 (OI980_11095) | 2322929..2323846 | + | 918 | WP_025912980.1 | DMT family transporter | - |
| OI980_RS11105 (OI980_11100) | 2323908..2324177 | + | 270 | WP_008499829.1 | DUF1778 domain-containing protein | Antitoxin |
| OI980_RS11110 (OI980_11105) | 2324184..2324705 | + | 522 | WP_045352937.1 | GNAT family N-acetyltransferase | Toxin |
| OI980_RS11115 (OI980_11110) | 2324779..2326101 | - | 1323 | WP_045352935.1 | pyrimidine utilization transport protein G | - |
| OI980_RS11120 (OI980_11115) | 2326123..2326617 | - | 495 | WP_023292823.1 | pyrimidine utilization flavin reductase protein F | - |
| OI980_RS11125 (OI980_11120) | 2326627..2327217 | - | 591 | WP_025912982.1 | malonic semialdehyde reductase | - |
| OI980_RS11130 (OI980_11125) | 2327227..2328027 | - | 801 | WP_045352934.1 | pyrimidine utilization protein D | - |
| OI980_RS11135 (OI980_11130) | 2328035..2328421 | - | 387 | WP_008499822.1 | pyrimidine utilization protein C | - |
| OI980_RS11140 (OI980_11135) | 2328433..2329122 | - | 690 | WP_045352931.1 | pyrimidine utilization protein B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19628.37 Da Isoelectric Point: 7.4313
>T262020 WP_045352937.1 NZ_CP109727:2324184-2324705 [Enterobacter roggenkampii]
VDNLTIEMFSEGKDYDFRGFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAIHKDLQGLEWGTTLVTHAMRVAYLASQAVGVHGIFVDALNDQAKQFYLKQGFIPLTDENSHSLF
FPTKSIERLFEQA
VDNLTIEMFSEGKDYDFRGFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAIHKDLQGLEWGTTLVTHAMRVAYLASQAVGVHGIFVDALNDQAKQFYLKQGFIPLTDENSHSLF
FPTKSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|