Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1671975..1672595 | Replicon | chromosome |
| Accession | NZ_CP109727 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | OI980_RS08020 | Protein ID | WP_008499287.1 |
| Coordinates | 1671975..1672193 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | OI980_RS08025 | Protein ID | WP_008499288.1 |
| Coordinates | 1672221..1672595 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI980_RS07990 (OI980_07990) | 1667988..1668248 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
| OI980_RS07995 (OI980_07995) | 1668251..1668391 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| OI980_RS08000 (OI980_08000) | 1668388..1669098 | - | 711 | WP_045352701.1 | GNAT family protein | - |
| OI980_RS08005 (OI980_08005) | 1669200..1670660 | + | 1461 | WP_045352700.1 | PLP-dependent aminotransferase family protein | - |
| OI980_RS08010 (OI980_08010) | 1670632..1671099 | - | 468 | WP_008499285.1 | YlaC family protein | - |
| OI980_RS08015 (OI980_08015) | 1671217..1671768 | - | 552 | WP_008499286.1 | maltose O-acetyltransferase | - |
| OI980_RS08020 (OI980_08020) | 1671975..1672193 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| OI980_RS08025 (OI980_08025) | 1672221..1672595 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| OI980_RS08030 (OI980_08030) | 1673105..1676251 | - | 3147 | WP_045352698.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OI980_RS08035 (OI980_08035) | 1676274..1677467 | - | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T262018 WP_008499287.1 NZ_CP109727:c1672193-1671975 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT262018 WP_008499288.1 NZ_CP109727:c1672595-1672221 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8SI38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |