Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 1167530..1168106 | Replicon | chromosome |
| Accession | NZ_CP109727 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A656ULU9 |
| Locus tag | OI980_RS05540 | Protein ID | WP_025912099.1 |
| Coordinates | 1167530..1167817 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A7D6YIG8 |
| Locus tag | OI980_RS05545 | Protein ID | WP_025912101.1 |
| Coordinates | 1167804..1168106 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI980_RS05510 (OI980_05510) | 1162773..1162889 | + | 117 | Protein_1057 | amino acid-binding protein | - |
| OI980_RS05515 (OI980_05515) | 1162882..1163347 | + | 466 | Protein_1058 | winged helix-turn-helix domain-containing protein | - |
| OI980_RS05520 (OI980_05520) | 1163493..1163963 | + | 471 | WP_021240623.1 | MarR family transcriptional regulator | - |
| OI980_RS05525 (OI980_05525) | 1163960..1165027 | + | 1068 | WP_025912094.1 | HlyD family secretion protein | - |
| OI980_RS05530 (OI980_05530) | 1165017..1166093 | + | 1077 | WP_032655052.1 | DUF2955 domain-containing protein | - |
| OI980_RS05535 (OI980_05535) | 1166090..1167361 | - | 1272 | WP_045353153.1 | DUF445 domain-containing protein | - |
| OI980_RS05540 (OI980_05540) | 1167530..1167817 | + | 288 | WP_025912099.1 | BrnT family toxin | Toxin |
| OI980_RS05545 (OI980_05545) | 1167804..1168106 | + | 303 | WP_025912101.1 | BrnA antitoxin family protein | Antitoxin |
| OI980_RS05550 (OI980_05550) | 1168137..1168775 | - | 639 | WP_045353154.1 | LysE family translocator | - |
| OI980_RS05555 (OI980_05555) | 1168823..1169566 | - | 744 | WP_045353155.1 | AraC family transcriptional regulator | - |
| OI980_RS05560 (OI980_05560) | 1169718..1171088 | + | 1371 | WP_045353156.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| OI980_RS05565 (OI980_05565) | 1171134..1171454 | - | 321 | WP_008501314.1 | hypothetical protein | - |
| OI980_RS05570 (OI980_05570) | 1171454..1171999 | - | 546 | WP_008501313.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11235.68 Da Isoelectric Point: 7.4007
>T262017 WP_025912099.1 NZ_CP109727:1167530-1167817 [Enterobacter roggenkampii]
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ULU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D6YIG8 |