Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 836348..836944 | Replicon | chromosome |
Accession | NZ_CP109727 | ||
Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A0F1DED9 |
Locus tag | OI980_RS03935 | Protein ID | WP_023293553.1 |
Coordinates | 836642..836944 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | W7P674 |
Locus tag | OI980_RS03930 | Protein ID | WP_021242718.1 |
Coordinates | 836348..836635 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI980_RS03925 (OI980_03925) | 834720..836351 | + | 1632 | WP_008503411.1 | Na/Pi cotransporter family protein | - |
OI980_RS03930 (OI980_03930) | 836348..836635 | - | 288 | WP_021242718.1 | putative addiction module antidote protein | Antitoxin |
OI980_RS03935 (OI980_03935) | 836642..836944 | - | 303 | WP_023293553.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OI980_RS03940 (OI980_03940) | 837142..838014 | + | 873 | WP_045352872.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
OI980_RS03945 (OI980_03945) | 838015..838287 | - | 273 | WP_014830263.1 | DUF3811 domain-containing protein | - |
OI980_RS03950 (OI980_03950) | 838338..839282 | - | 945 | WP_023293551.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
OI980_RS03955 (OI980_03955) | 839388..840962 | - | 1575 | WP_032654615.1 | RNA repair transcriptional activator RtcR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11459.24 Da Isoelectric Point: 10.1771
>T262016 WP_023293553.1 NZ_CP109727:c836944-836642 [Enterobacter roggenkampii]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F1DED9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7P674 |