Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 40486..41225 | Replicon | plasmid p2017-45-54-05_2 |
| Accession | NZ_CP109697 | ||
| Organism | Enterobacter asburiae strain 2017-45-54-05 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A5E1AVR5 |
| Locus tag | OI909_RS24935 | Protein ID | WP_013087172.1 |
| Coordinates | 40486..40971 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A5E1AWX8 |
| Locus tag | OI909_RS24940 | Protein ID | WP_012540086.1 |
| Coordinates | 40959..41225 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI909_RS24915 (OI909_24910) | 36476..36745 | + | 270 | WP_004196355.1 | nickel-sensing transcriptional repressor NcrB | - |
| OI909_RS24920 (OI909_24915) | 36758..37888 | + | 1131 | WP_004196366.1 | Ni(II)/Co(II) efflux transporter permease subunit NcrC | - |
| OI909_RS24925 (OI909_24920) | 38050..38472 | + | 423 | WP_032072095.1 | nickel resistance OB fold protein NcrY | - |
| OI909_RS24930 (OI909_24925) | 38728..40068 | - | 1341 | WP_004196353.1 | IS1202-like element ISEsa1 family transposase | - |
| OI909_RS24935 (OI909_24930) | 40486..40971 | - | 486 | WP_013087172.1 | GNAT family N-acetyltransferase | Toxin |
| OI909_RS24940 (OI909_24935) | 40959..41225 | - | 267 | WP_012540086.1 | DUF1778 domain-containing protein | Antitoxin |
| OI909_RS24945 (OI909_24940) | 41525..41848 | + | 324 | WP_013087171.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| OI909_RS24950 (OI909_24945) | 41850..42563 | + | 714 | Protein_61 | arsenical resistance protein ArsH | - |
| OI909_RS24955 (OI909_24950) | 42572..43117 | + | 546 | WP_013087169.1 | sigma-70 family RNA polymerase sigma factor | - |
| OI909_RS24960 (OI909_24955) | 43193..43555 | + | 363 | WP_013087168.1 | arsenic metallochaperone ArsD family protein | - |
| OI909_RS24965 (OI909_24960) | 43576..45333 | + | 1758 | WP_013087167.1 | arsenical pump-driving ATPase | - |
| OI909_RS24970 (OI909_24965) | 45458..45994 | + | 537 | WP_013087166.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..125451 | 125451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17810.62 Da Isoelectric Point: 9.8560
>T262013 WP_013087172.1 NZ_CP109697:c40971-40486 [Enterobacter asburiae]
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1AVR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1AWX8 |