Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 27359..27885 | Replicon | plasmid p2017-45-54-05_2 |
Accession | NZ_CP109697 | ||
Organism | Enterobacter asburiae strain 2017-45-54-05 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | OI909_RS24850 | Protein ID | WP_000323025.1 |
Coordinates | 27359..27646 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | OI909_RS24855 | Protein ID | WP_004196370.1 |
Coordinates | 27646..27885 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI909_RS24815 (OI909_24810) | 22830..23117 | - | 288 | WP_047345096.1 | hypothetical protein | - |
OI909_RS24820 (OI909_24815) | 23196..23987 | - | 792 | WP_013087183.1 | N-6 DNA methylase | - |
OI909_RS24825 (OI909_24820) | 24028..24228 | - | 201 | WP_013087182.1 | hypothetical protein | - |
OI909_RS24830 (OI909_24825) | 24316..24777 | - | 462 | WP_013087181.1 | hypothetical protein | - |
OI909_RS24835 (OI909_24830) | 24838..25152 | - | 315 | WP_047345097.1 | hypothetical protein | - |
OI909_RS24840 (OI909_24835) | 26032..26142 | - | 111 | WP_230678187.1 | DUF5431 family protein | - |
OI909_RS24845 (OI909_24840) | 26258..27292 | + | 1035 | Protein_40 | IS481 family transposase | - |
OI909_RS24850 (OI909_24845) | 27359..27646 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
OI909_RS24855 (OI909_24850) | 27646..27885 | - | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
OI909_RS24860 (OI909_24855) | 27910..28008 | + | 99 | Protein_43 | protein YdfV | - |
OI909_RS24865 (OI909_24860) | 28136..28501 | + | 366 | WP_009651956.1 | hypothetical protein | - |
OI909_RS24870 (OI909_24865) | 28545..29282 | + | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
OI909_RS24875 (OI909_24870) | 29296..29985 | + | 690 | WP_004196322.1 | hypothetical protein | - |
OI909_RS24880 (OI909_24875) | 30016..31392 | - | 1377 | WP_004196363.1 | chromate efflux transporter | - |
OI909_RS24885 (OI909_24880) | 31349..32326 | - | 978 | WP_004196334.1 | chromate resistance protein | - |
OI909_RS24890 (OI909_24885) | 32356..32548 | + | 193 | Protein_49 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..125451 | 125451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T262012 WP_000323025.1 NZ_CP109697:c27646-27359 [Enterobacter asburiae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|