Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4833850..4834426 | Replicon | chromosome |
Accession | NZ_CP109694 | ||
Organism | Enterobacter asburiae strain 2017-45-54-05 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A4R0G892 |
Locus tag | OI909_RS23525 | Protein ID | WP_010427219.1 |
Coordinates | 4833850..4834137 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | OI909_RS23530 | Protein ID | WP_048976412.1 |
Coordinates | 4834124..4834426 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI909_RS23500 (OI909_23495) | 4828966..4829661 | + | 696 | WP_182072048.1 | winged helix-turn-helix domain-containing protein | - |
OI909_RS23505 (OI909_23500) | 4829811..4830281 | + | 471 | WP_033144545.1 | MarR family transcriptional regulator | - |
OI909_RS23510 (OI909_23505) | 4830278..4831345 | + | 1068 | WP_127353288.1 | HlyD family secretion protein | - |
OI909_RS23515 (OI909_23510) | 4831335..4832411 | + | 1077 | WP_023310256.1 | DUF2955 domain-containing protein | - |
OI909_RS23520 (OI909_23515) | 4832408..4833679 | - | 1272 | WP_039260963.1 | DUF445 domain-containing protein | - |
OI909_RS23525 (OI909_23520) | 4833850..4834137 | + | 288 | WP_010427219.1 | BrnT family toxin | Toxin |
OI909_RS23530 (OI909_23525) | 4834124..4834426 | + | 303 | WP_048976412.1 | BrnA antitoxin family protein | Antitoxin |
OI909_RS23535 (OI909_23530) | 4834457..4835095 | - | 639 | WP_182072050.1 | LysE family translocator | - |
OI909_RS23540 (OI909_23535) | 4835143..4835886 | - | 744 | WP_182072052.1 | AraC family transcriptional regulator | - |
OI909_RS23545 (OI909_23540) | 4836038..4837408 | + | 1371 | WP_182072054.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
OI909_RS23550 (OI909_23545) | 4837453..4837773 | - | 321 | WP_182072056.1 | hypothetical protein | - |
OI909_RS23555 (OI909_23550) | 4837773..4838318 | - | 546 | WP_023310269.1 | YfaZ family outer membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11174.64 Da Isoelectric Point: 6.7609
>T262010 WP_010427219.1 NZ_CP109694:4833850-4834137 [Enterobacter asburiae]
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|