Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 4507777..4508369 | Replicon | chromosome |
| Accession | NZ_CP109694 | ||
| Organism | Enterobacter asburiae strain 2017-45-54-05 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OI909_RS21950 | Protein ID | WP_182072249.1 |
| Coordinates | 4508067..4508369 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | OI909_RS21945 | Protein ID | WP_096151293.1 |
| Coordinates | 4507777..4508064 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI909_RS21940 (OI909_21935) | 4506149..4507780 | + | 1632 | WP_033144374.1 | Na/Pi cotransporter family protein | - |
| OI909_RS21945 (OI909_21940) | 4507777..4508064 | - | 288 | WP_096151293.1 | putative addiction module antidote protein | Antitoxin |
| OI909_RS21950 (OI909_21945) | 4508067..4508369 | - | 303 | WP_182072249.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OI909_RS21955 (OI909_21950) | 4508567..4509439 | + | 873 | WP_033144377.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| OI909_RS21960 (OI909_21955) | 4509440..4509712 | - | 273 | WP_023309994.1 | DUF3811 domain-containing protein | - |
| OI909_RS21965 (OI909_21960) | 4509763..4510707 | - | 945 | WP_096151294.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| OI909_RS21970 (OI909_21965) | 4510801..4512150 | - | 1350 | WP_023309996.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11284.02 Da Isoelectric Point: 9.9325
>T262009 WP_182072249.1 NZ_CP109694:c4508369-4508067 [Enterobacter asburiae]
MKEIVQTESFQRWEQNLKDRRAKTIIASRLFRLANGLAGDIKPVGEGISELRIHYGPGYRLYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNPNGRSE
MKEIVQTESFQRWEQNLKDRRAKTIIASRLFRLANGLAGDIKPVGEGISELRIHYGPGYRLYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNPNGRSE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|