Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 4283303..4283965 | Replicon | chromosome |
Accession | NZ_CP109694 | ||
Organism | Enterobacter asburiae strain 2017-45-54-05 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OI909_RS20925 | Protein ID | WP_176686521.1 |
Coordinates | 4283567..4283965 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OI909_RS20920 | Protein ID | WP_182072104.1 |
Coordinates | 4283303..4283563 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI909_RS20905 (OI909_20900) | 4280728..4281849 | - | 1122 | WP_284592962.1 | efflux RND transporter periplasmic adaptor subunit | - |
OI909_RS20910 (OI909_20905) | 4281998..4282567 | - | 570 | WP_033144322.1 | helix-turn-helix domain-containing protein | - |
OI909_RS20915 (OI909_20910) | 4282754..4283173 | + | 420 | WP_182072102.1 | GNAT family N-acetyltransferase | - |
OI909_RS20920 (OI909_20915) | 4283303..4283563 | + | 261 | WP_182072104.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OI909_RS20925 (OI909_20920) | 4283567..4283965 | + | 399 | WP_176686521.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OI909_RS20930 (OI909_20925) | 4284106..4284906 | + | 801 | WP_182072106.1 | lipoprotein NlpA | - |
OI909_RS20935 (OI909_20930) | 4285029..4285808 | + | 780 | WP_182072108.1 | MBL fold metallo-hydrolase | - |
OI909_RS20940 (OI909_20935) | 4285835..4286788 | + | 954 | WP_182072110.1 | helix-turn-helix domain-containing protein | - |
OI909_RS20945 (OI909_20940) | 4286972..4288669 | + | 1698 | WP_233476967.1 | ShlB/FhaC/HecB family hemolysin secretion/activation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14961.16 Da Isoelectric Point: 6.0840
>T262008 WP_176686521.1 NZ_CP109694:4283567-4283965 [Enterobacter asburiae]
MLHMLDTNMVSHLVRQHPGVLEQYSRTPTEKMCISSVTEAELLYGIAKKQNDTLQKTILEFLKTITICDWDSDAAATYGE
LRAAMEKRGKVMGDLDQLIAAHAISRRTTIVTNDRAFRMVQELTVEDWTTTS
MLHMLDTNMVSHLVRQHPGVLEQYSRTPTEKMCISSVTEAELLYGIAKKQNDTLQKTILEFLKTITICDWDSDAAATYGE
LRAAMEKRGKVMGDLDQLIAAHAISRRTTIVTNDRAFRMVQELTVEDWTTTS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|