Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3390100..3390757 | Replicon | chromosome |
| Accession | NZ_CP109694 | ||
| Organism | Enterobacter asburiae strain 2017-45-54-05 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OI909_RS16555 | Protein ID | WP_182071664.1 |
| Coordinates | 3390100..3390510 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V3PWU7 |
| Locus tag | OI909_RS16560 | Protein ID | WP_010435322.1 |
| Coordinates | 3390491..3390757 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI909_RS16535 (OI909_16530) | 3386093..3387826 | - | 1734 | WP_039262981.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OI909_RS16540 (OI909_16535) | 3387832..3388545 | - | 714 | WP_047060452.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OI909_RS16545 (OI909_16540) | 3388574..3389470 | - | 897 | WP_023309098.1 | site-specific tyrosine recombinase XerD | - |
| OI909_RS16550 (OI909_16545) | 3389572..3390093 | + | 522 | WP_039262979.1 | flavodoxin FldB | - |
| OI909_RS16555 (OI909_16550) | 3390100..3390510 | - | 411 | WP_182071664.1 | protein YgfX | Toxin |
| OI909_RS16560 (OI909_16555) | 3390491..3390757 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
| OI909_RS16565 (OI909_16560) | 3391052..3392032 | + | 981 | WP_029739202.1 | tRNA-modifying protein YgfZ | - |
| OI909_RS16570 (OI909_16565) | 3392107..3392766 | - | 660 | WP_033146591.1 | hemolysin III family protein | - |
| OI909_RS16575 (OI909_16570) | 3392932..3393243 | - | 312 | WP_048980550.1 | N(4)-acetylcytidine aminohydrolase | - |
| OI909_RS16580 (OI909_16575) | 3393295..3394026 | + | 732 | WP_032660101.1 | MurR/RpiR family transcriptional regulator | - |
| OI909_RS16585 (OI909_16580) | 3394143..3395576 | + | 1434 | WP_096151314.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16111.11 Da Isoelectric Point: 10.9468
>T262006 WP_182071664.1 NZ_CP109694:c3390510-3390100 [Enterobacter asburiae]
VVLWQSDLRVSWRSQWMSLLLHGLIAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLIAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|