Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2458277..2458867 | Replicon | chromosome |
| Accession | NZ_CP109694 | ||
| Organism | Enterobacter asburiae strain 2017-45-54-05 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | OI909_RS12125 | Protein ID | WP_058841450.1 |
| Coordinates | 2458277..2458609 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | OI909_RS12130 | Protein ID | WP_058841451.1 |
| Coordinates | 2458610..2458867 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI909_RS12110 (OI909_12105) | 2454441..2455766 | + | 1326 | WP_182072112.1 | SidA/IucD/PvdA family monooxygenase | - |
| OI909_RS12115 (OI909_12110) | 2455793..2457982 | + | 2190 | WP_047061141.1 | TonB-dependent siderophore receptor | - |
| OI909_RS12125 (OI909_12120) | 2458277..2458609 | - | 333 | WP_058841450.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OI909_RS12130 (OI909_12125) | 2458610..2458867 | - | 258 | WP_058841451.1 | hypothetical protein | Antitoxin |
| OI909_RS12135 (OI909_12130) | 2459159..2459548 | - | 390 | WP_096150847.1 | RidA family protein | - |
| OI909_RS12140 (OI909_12135) | 2459690..2460610 | + | 921 | WP_048980124.1 | LysR family transcriptional regulator | - |
| OI909_RS12145 (OI909_12140) | 2460686..2460988 | - | 303 | WP_029741460.1 | XRE family transcriptional regulator | - |
| OI909_RS12150 (OI909_12145) | 2460993..2461346 | - | 354 | WP_048980127.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OI909_RS12155 (OI909_12150) | 2461524..2462417 | - | 894 | WP_048980130.1 | LysR substrate-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11757.57 Da Isoelectric Point: 9.4051
>T262003 WP_058841450.1 NZ_CP109694:c2458609-2458277 [Enterobacter asburiae]
MDRGEIWLVSLDPIAGHEQSGKRPVLVVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTTTTGVIRCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLVVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTTTTGVIRCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|