Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 49095..49738 | Replicon | plasmid p2017-45-80_1 |
| Accession | NZ_CP109693 | ||
| Organism | Enterobacter asburiae strain 2017-45-80 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OI907_RS23130 | Protein ID | WP_284582740.1 |
| Coordinates | 49095..49511 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OI907_RS23135 | Protein ID | WP_001261282.1 |
| Coordinates | 49508..49738 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI907_RS23105 (44692) | 44692..45189 | + | 498 | WP_023327707.1 | hypothetical protein | - |
| OI907_RS23110 (45351) | 45351..46055 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OI907_RS23115 (46163) | 46163..46741 | - | 579 | WP_004206571.1 | recombinase family protein | - |
| OI907_RS23120 (46901) | 46901..48100 | + | 1200 | Protein_57 | DUF4158 domain-containing protein | - |
| OI907_RS23125 (48166) | 48166..48870 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OI907_RS23130 (49095) | 49095..49511 | - | 417 | WP_284582740.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OI907_RS23135 (49508) | 49508..49738 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OI907_RS23140 (49695) | 49695..49937 | + | 243 | Protein_61 | hypothetical protein | - |
| OI907_RS23145 (50239) | 50239..50529 | + | 291 | WP_013087126.1 | hypothetical protein | - |
| OI907_RS23150 (50684) | 50684..51190 | + | 507 | WP_239508013.1 | hypothetical protein | - |
| OI907_RS23155 (51209) | 51209..51985 | + | 777 | WP_023327688.1 | site-specific integrase | - |
| OI907_RS23160 (52187) | 52187..52444 | + | 258 | Protein_65 | site-specific integrase | - |
| OI907_RS23165 (52688) | 52688..53698 | - | 1011 | WP_015572055.1 | RepB family plasmid replication initiator protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..79034 | 79034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15128.59 Da Isoelectric Point: 7.1082
>T261996 WP_284582740.1 NZ_CP109693:c49511-49095 [Enterobacter asburiae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|