Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 49095..49738 Replicon plasmid p2017-45-80_1
Accession NZ_CP109693
Organism Enterobacter asburiae strain 2017-45-80

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OI907_RS23130 Protein ID WP_284582740.1
Coordinates 49095..49511 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OI907_RS23135 Protein ID WP_001261282.1
Coordinates 49508..49738 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI907_RS23105 (44692) 44692..45189 + 498 WP_023327707.1 hypothetical protein -
OI907_RS23110 (45351) 45351..46055 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
OI907_RS23115 (46163) 46163..46741 - 579 WP_004206571.1 recombinase family protein -
OI907_RS23120 (46901) 46901..48100 + 1200 Protein_57 DUF4158 domain-containing protein -
OI907_RS23125 (48166) 48166..48870 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
OI907_RS23130 (49095) 49095..49511 - 417 WP_284582740.1 type II toxin-antitoxin system VapC family toxin Toxin
OI907_RS23135 (49508) 49508..49738 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OI907_RS23140 (49695) 49695..49937 + 243 Protein_61 hypothetical protein -
OI907_RS23145 (50239) 50239..50529 + 291 WP_013087126.1 hypothetical protein -
OI907_RS23150 (50684) 50684..51190 + 507 WP_239508013.1 hypothetical protein -
OI907_RS23155 (51209) 51209..51985 + 777 WP_023327688.1 site-specific integrase -
OI907_RS23160 (52187) 52187..52444 + 258 Protein_65 site-specific integrase -
OI907_RS23165 (52688) 52688..53698 - 1011 WP_015572055.1 RepB family plasmid replication initiator protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..79034 79034


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15128.59 Da        Isoelectric Point: 7.1082

>T261996 WP_284582740.1 NZ_CP109693:c49511-49095 [Enterobacter asburiae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT261996 WP_001261282.1 NZ_CP109693:c49738-49508 [Enterobacter asburiae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References