Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 4394921..4395511 | Replicon | chromosome |
| Accession | NZ_CP109692 | ||
| Organism | Enterobacter asburiae strain 2017-45-80 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | OI907_RS21615 | Protein ID | WP_033145927.1 |
| Coordinates | 4395179..4395511 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | OI907_RS21610 | Protein ID | WP_033145928.1 |
| Coordinates | 4394921..4395178 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI907_RS21580 (OI907_21560) | 4390592..4391200 | - | 609 | WP_080277780.1 | glutathione S-transferase family protein | - |
| OI907_RS21585 (OI907_21565) | 4391371..4392264 | + | 894 | WP_033145932.1 | LysR substrate-binding domain-containing protein | - |
| OI907_RS21590 (OI907_21570) | 4392442..4392795 | + | 354 | WP_033145931.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OI907_RS21595 (OI907_21575) | 4392800..4393102 | + | 303 | WP_029741460.1 | XRE family transcriptional regulator | - |
| OI907_RS21600 (OI907_21580) | 4393178..4394098 | - | 921 | WP_033145930.1 | LysR family transcriptional regulator | - |
| OI907_RS21605 (OI907_21585) | 4394240..4394629 | + | 390 | WP_033145929.1 | RidA family protein | - |
| OI907_RS21610 (OI907_21590) | 4394921..4395178 | + | 258 | WP_033145928.1 | antitoxin | Antitoxin |
| OI907_RS21615 (OI907_21595) | 4395179..4395511 | + | 333 | WP_033145927.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OI907_RS21620 (OI907_21600) | 4395468..4395662 | - | 195 | WP_080277779.1 | hypothetical protein | - |
| OI907_RS21625 (OI907_21605) | 4395832..4397193 | - | 1362 | WP_003036316.1 | HEPN/Toprim-associated domain-containing protein | - |
| OI907_RS21630 (OI907_21610) | 4398029..4398967 | + | 939 | WP_003036321.1 | hypothetical protein | - |
| OI907_RS21635 (OI907_21615) | 4399043..4399525 | + | 483 | WP_003036324.1 | hypothetical protein | - |
| OI907_RS21640 (OI907_21620) | 4399547..4400350 | + | 804 | WP_003036327.1 | TIGR02391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4383912..4412537 | 28625 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11828.65 Da Isoelectric Point: 9.4051
>T261990 WP_033145927.1 NZ_CP109692:4395179-4395511 [Enterobacter asburiae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTTTTGVIRCDQPRTI
DMSARNGMRLERIPDAVINEVLARLDAILN
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTTTTGVIRCDQPRTI
DMSARNGMRLERIPDAVINEVLARLDAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|