Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4164819..4165345 | Replicon | chromosome |
| Accession | NZ_CP109692 | ||
| Organism | Enterobacter asburiae strain 2017-45-80 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | OI907_RS20410 | Protein ID | WP_000323025.1 |
| Coordinates | 4165058..4165345 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | OI907_RS20405 | Protein ID | WP_000534858.1 |
| Coordinates | 4164819..4165058 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI907_RS20375 (OI907_20355) | 4160853..4161425 | - | 573 | WP_008500940.1 | elongation factor P-like protein YeiP | - |
| OI907_RS20380 (OI907_20360) | 4161590..4161844 | + | 255 | WP_033146563.1 | YkgJ family cysteine cluster protein | - |
| OI907_RS20385 (OI907_20365) | 4161841..4162101 | - | 261 | Protein_3888 | MFS transporter | - |
| OI907_RS20390 (OI907_20370) | 4162177..4163517 | + | 1341 | WP_004196353.1 | IS1202-like element ISEsa1 family transposase | - |
| OI907_RS20395 (OI907_20375) | 4163954..4164286 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
| OI907_RS20400 (OI907_20380) | 4164489..4164794 | - | 306 | WP_001326990.1 | protein YdfV | - |
| OI907_RS20405 (OI907_20385) | 4164819..4165058 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| OI907_RS20410 (OI907_20390) | 4165058..4165345 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| OI907_RS20415 (OI907_20395) | 4165404..4166339 | - | 936 | Protein_3894 | MFS transporter | - |
| OI907_RS20420 (OI907_20400) | 4166701..4167831 | + | 1131 | WP_033146038.1 | fused PTS fructose transporter subunit IIA/HPr protein | - |
| OI907_RS20425 (OI907_20405) | 4167831..4168769 | + | 939 | WP_014170919.1 | 1-phosphofructokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T261988 WP_000323025.1 NZ_CP109692:4165058-4165345 [Enterobacter asburiae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|