Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3442129..3442786 | Replicon | chromosome |
| Accession | NZ_CP109692 | ||
| Organism | Enterobacter asburiae strain 2017-45-80 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | OI907_RS16975 | Protein ID | WP_021242050.1 |
| Coordinates | 3442376..3442786 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V3PWU7 |
| Locus tag | OI907_RS16970 | Protein ID | WP_010435322.1 |
| Coordinates | 3442129..3442395 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI907_RS16945 (OI907_16925) | 3437310..3438743 | - | 1434 | WP_033146593.1 | 6-phospho-beta-glucosidase BglA | - |
| OI907_RS16950 (OI907_16930) | 3438860..3439591 | - | 732 | WP_029739204.1 | MurR/RpiR family transcriptional regulator | - |
| OI907_RS16955 (OI907_16935) | 3439643..3439954 | + | 312 | WP_033146592.1 | N(4)-acetylcytidine aminohydrolase | - |
| OI907_RS16960 (OI907_16940) | 3440120..3440779 | + | 660 | WP_033146591.1 | hemolysin III family protein | - |
| OI907_RS16965 (OI907_16945) | 3440854..3441834 | - | 981 | WP_033146590.1 | tRNA-modifying protein YgfZ | - |
| OI907_RS16970 (OI907_16950) | 3442129..3442395 | + | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
| OI907_RS16975 (OI907_16955) | 3442376..3442786 | + | 411 | WP_021242050.1 | protein YgfX | Toxin |
| OI907_RS16980 (OI907_16960) | 3442793..3443314 | - | 522 | WP_023309099.1 | flavodoxin FldB | - |
| OI907_RS16985 (OI907_16965) | 3443416..3444312 | + | 897 | WP_023309098.1 | site-specific tyrosine recombinase XerD | - |
| OI907_RS16990 (OI907_16970) | 3444341..3445054 | + | 714 | WP_029740340.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OI907_RS16995 (OI907_16975) | 3445060..3446793 | + | 1734 | WP_033146589.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T261986 WP_021242050.1 NZ_CP109692:3442376-3442786 [Enterobacter asburiae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PWU7 |