Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2674831..2675447 | Replicon | chromosome |
| Accession | NZ_CP109692 | ||
| Organism | Enterobacter asburiae strain 2017-45-80 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OI907_RS13170 | Protein ID | WP_080277799.1 |
| Coordinates | 2675076..2675447 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OI907_RS13165 | Protein ID | WP_033146961.1 |
| Coordinates | 2674831..2675073 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI907_RS13135 (OI907_13120) | 2670249..2670719 | + | 471 | WP_033146967.1 | hypothetical protein | - |
| OI907_RS13140 (OI907_13125) | 2670808..2671407 | + | 600 | WP_033146966.1 | glucose-1-phosphatase | - |
| OI907_RS13145 (OI907_13130) | 2671401..2672282 | + | 882 | WP_033146965.1 | virulence factor BrkB family protein | - |
| OI907_RS13150 (OI907_13135) | 2672279..2672716 | + | 438 | WP_033146964.1 | D-aminoacyl-tRNA deacylase | - |
| OI907_RS13155 (OI907_13140) | 2672761..2673702 | + | 942 | WP_033146963.1 | fatty acid biosynthesis protein FabY | - |
| OI907_RS13160 (OI907_13145) | 2673711..2674631 | - | 921 | WP_033146962.1 | alpha/beta hydrolase | - |
| OI907_RS13165 (OI907_13150) | 2674831..2675073 | + | 243 | WP_033146961.1 | CopG family transcriptional regulator | Antitoxin |
| OI907_RS13170 (OI907_13155) | 2675076..2675447 | + | 372 | WP_080277799.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OI907_RS13175 (OI907_13160) | 2675487..2676416 | - | 930 | WP_023309751.1 | formate dehydrogenase accessory protein FdhE | - |
| OI907_RS13180 (OI907_13165) | 2676413..2677048 | - | 636 | WP_010436852.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OI907_RS13185 (OI907_13170) | 2677045..2677947 | - | 903 | WP_010436855.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13687.90 Da Isoelectric Point: 6.9789
>T261985 WP_080277799.1 NZ_CP109692:2675076-2675447 [Enterobacter asburiae]
MEHMAVFDTNILIDLFNNRVEAADAIDRTASHRAISLITWMEVMVGARKHGHEAKTATVMGVFEIIDITRDIAERSVILR
EKHGMKLPDAIILATAQSRSCPLISRNTKDFLGITGVVSPYQL
MEHMAVFDTNILIDLFNNRVEAADAIDRTASHRAISLITWMEVMVGARKHGHEAKTATVMGVFEIIDITRDIAERSVILR
EKHGMKLPDAIILATAQSRSCPLISRNTKDFLGITGVVSPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|