Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2087282..2087798 | Replicon | chromosome |
Accession | NZ_CP109692 | ||
Organism | Enterobacter asburiae strain 2017-45-80 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7W2VUY1 |
Locus tag | OI907_RS10430 | Protein ID | WP_033144499.1 |
Coordinates | 2087282..2087566 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V3EXX3 |
Locus tag | OI907_RS10435 | Protein ID | WP_008501400.1 |
Coordinates | 2087556..2087798 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI907_RS10415 (OI907_10400) | 2082514..2084157 | + | 1644 | WP_033144501.1 | alpha,alpha-phosphotrehalase | - |
OI907_RS10420 (OI907_10405) | 2084534..2086672 | + | 2139 | WP_032662478.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OI907_RS10425 (OI907_10410) | 2086814..2087278 | + | 465 | WP_033144500.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OI907_RS10430 (OI907_10415) | 2087282..2087566 | - | 285 | WP_033144499.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OI907_RS10435 (OI907_10420) | 2087556..2087798 | - | 243 | WP_008501400.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OI907_RS10440 (OI907_10425) | 2087876..2089786 | - | 1911 | WP_033144498.1 | PRD domain-containing protein | - |
OI907_RS10445 (OI907_10430) | 2089806..2090942 | - | 1137 | WP_033144497.1 | lactonase family protein | - |
OI907_RS10450 (OI907_10435) | 2091057..2091797 | - | 741 | WP_033144496.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.3350
>T261982 WP_033144499.1 NZ_CP109692:c2087566-2087282 [Enterobacter asburiae]
MTYELAFDPRALKEWSKLGQTVKDQFKKKLADVLVSPRVESARLHGLPDCYKIKLRSQGYRLVYQVQDNVVTVFVIAIGK
REKSAVYHDANKRL
MTYELAFDPRALKEWSKLGQTVKDQFKKKLADVLVSPRVESARLHGLPDCYKIKLRSQGYRLVYQVQDNVVTVFVIAIGK
REKSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W2VUY1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3EXX3 |